Description

  • Product name

    Recombinant Human USP37 protein
  • Expression system

    Wheat germ
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ILGSRTSQKETSRQLSYSDNQASAKRGSLETKDDIPFRKVLGNPGRGSIK TVAGSGIARTIPSLTSTSTPLRSGLLENRTEKRKRMISTGSELNEDYPKE NDSSSN
    • Amino acids

      123 to 228
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163625 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Deubiquitinating enzyme 3
    • Deubiquitinating enzyme 37
    • EC 3.1.2.15
    • KIAA1594
    • MGC117261
    • OTTHUMP00000164146
    • tmp_locus_50
    • Ubiquitin carboxyl-terminal hydrolase 37
    • Ubiquitin specific peptidase 37
    • Ubiquitin specific processing protease 37
    • Ubiquitin specific protease 37
    • Ubiquitin thioesterase 37
    • Ubiquitin thiolesterase 37
    • Ubiquitin-specific-processing protease 37
    • UBP37_HUMAN
    • USP37
    see all
  • Tissue specificity

    Expressed in brain and prostate.
  • Sequence similarities

    Belongs to the peptidase C19 family.
    Contains 3 UIM (ubiquitin-interacting motif) repeats.
  • Information by UniProt

Images

  • ab163625 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163625 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163625.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up