Description

  • Product name

    Recombinant Human USP4 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAEGGGCRERPDAETQKSELGPLMRTTLQRGAQWYLIDSRWFKQWKKYVG FDSWDMYNVGEHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPTEA WNKLLNWYGCVEGQQPIVRKVVEHGLFVKHCKVEVYLLELKLCENSDPTN VLSCHFSKADTIATIEKEMRKLFNIPAERETRLWNKYMSNTYEQLSKLDN TVQDAGLYQGQVLVIEPQNEDGTWPRQTLQSKSSTAPSRNFTTSPKSSAS PYSSVSASLIANGDSTSTCGMHSSGVSRGGSGFSASYNCQEPPSSHIQPG LCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGE IAEAYAELIKQMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAF LLDGLHEDLNRVKKKPYLELKDANGRPDAVVAKEAWENHRLRNDSVIVDT FHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLKKDRVMEVFLVPADPHC RPTQYRVTVPLMGAVSDLCEALSRLSGIAAENMVVADVYNHRFHKIFQMD EGLNHIMPRDDIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASAL YGQPLLLSVPKHKLTLESLYQAVCDRISRYVKQPLPDEFGSSPLEPGACN GSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQ PCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLY YDEQESEAYEKHVSMLQPQKKKKTTVALRDCIELFTTMETLGEHDPWYCP NCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDTVVEFPIRGLN MSEFVCNLSARPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDS NVSLASEDQIVTKAAYVLFYQRRDDEFYKTPSLSSSGSSDGGTRPSSSQQ GFGDDEACSMDTN
    • Predicted molecular weight

      135 kDa including tags
    • Amino acids

      1 to 963

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131959 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Deubiquitinating enzyme 4
    • MGC149848
    • MGC149849
    • Proto oncogene
    • Protooncogene
    • Ubiquitin carboxyl terminal hydrolase 4
    • Ubiquitin carboxyl-terminal hydrolase 4
    • Ubiquitin specific peptidase 4
    • Ubiquitin specific peptidase 4 (proto oncogene)
    • Ubiquitin specific peptidase 4 (protooncogene)
    • Ubiquitin specific processing protease 4
    • Ubiquitin specific protease 4
    • Ubiquitin specific protease 4 (proto oncogene)
    • Ubiquitin specific protease 4 (protooncogene)
    • Ubiquitin specific protease proto oncogene
    • Ubiquitin specific protease protooncogene
    • Ubiquitin thioesterase 4
    • Ubiquitin thiolesterase 4
    • Ubiquitin-specific-processing protease 4
    • Ubiquitous nuclear protein homolog
    • UBP4_HUMAN
    • UNP
    • UNPH
    • USP 4
    • USP4
    see all
  • Function

    Hydrolase that deubiquitinates target proteins such as the receptor ADORA2A and TRIM21. Deubiquitination of ADORA2A increases the amount of functional receptor at the cell surface. Plays a role in the regulation of quality control in the ER.
  • Tissue specificity

    Overexpressed in small cell tumors and adenocarcinomas of the lung compared to wild-type lung (at protein level). Expressed in the hippocampal neurons.
  • Sequence similarities

    Belongs to the peptidase C19 family. USP4 subfamily.
    Contains 1 DUSP domain.
  • Post-translational
    modifications

    Monoubiquitinated by TRIM21. Ubiquitination does not lead to its proteasomal degradation. Autodeubiquitinated.
  • Cellular localization

    Cytoplasm. Nucleus. Shuttles between the nucleus and cytoplasm. Exported to the cytoplasm in a CRM1-dependent manner and recycled back to the nucleus via the importin alpha/beta heterodimeric import receptor. The relative amounts found in the nucleus and cytoplasm vary according to the cell type.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131959 stained with Coomassie Blue.

References

ab131959 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131959.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up