Overview

  • Product name

    Recombinant Human USP48 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCKG NPNCLVGIGEHIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYV NTFLQVWFLNLELRQALYLCPSTCSDYMLGDGIQEEKDYEPQTICEHLQY LFALLQNSNRRYIDPSGFVKALGLDTGQQQDAQEFSKLFMSLLEDTLSKQ KNPDVRNIVQQQFCGEYAYVTVCNQCGRESKLLSKFYELELNIQGHKQLT DCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFV FDRQTGHKKKLNTYIGFSEILDMEPYVEHKGGSYVYELSAVLIHRGVSAY SGHYIAHVKDPQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRK PKCGKGTHCSRNAYMLVYRLQTQEKPNTTVQVPAFLQELVDRDNSKFEEW CIEMAEMRKQSVDKGKAKHEEVKELYQRLPAGAEPYEFVSLEWLQKWLDE STPTKPIDNHACLCSHDKLHPDKISIMKRISEYAADIFYSRYGGGPRLTV KALCKECVVERCRILRLKNQLNEDYKTVNNLLKAAVKGSDGFWVGKSSLR SWRQLALEQLDEQDGDAEQSNGKMNGSTLNKDESKEERKEEEELNFNEDI LCPHGELCISENERRLVSKEAWSKLQQYFPKAPEFPSYKECCSQCKILER EGEENEALHKMIANEQKTSLPNLFQDKNRPCLSNWPEDTDVLYIVSQFFV EEWRKFVRKPTRCSPVSSVGNSALLCPHGGLMFTFASMTKEDSKLIALIW PSEWQMIQKLFVVDHVIKITRIEVGDVNPSETQYISEPKLCPECREGLLC QQQRDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPD GEKDPDFNQSNGGTKRQKISHQNYIAYQKQVIRRSMRHRKVRGEKALLVS ANQTLKELKIQIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIPESVI LLKADEPIADYAAMDDVMQVCMPEEGFKGTGLLGH
    • Molecular weight

      145 kDa including tags
    • Amino acids

      1 to 1035

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132691 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AAH67261
    • Deubiquitinating enzyme 48
    • DKFZp762M1713
    • EC 3.1.2.15
    • Kiaa4202
    • MGC132556
    • MGC14879
    • RAP1GA1
    • Synaptic ubiquitin specific protease
    • synUSP
    • Ubiquitin carboxyl terminal hydrolase 48
    • Ubiquitin carboxyl-terminal hydrolase 48
    • Ubiquitin specific peptidase 48
    • Ubiquitin specific processing protease 48
    • Ubiquitin specific protease 31
    • Ubiquitin specific protease 48
    • Ubiquitin thioesterase 48
    • Ubiquitin thiolesterase 48
    • Ubiquitin-specific-processing protease 48
    • UBP48_HUMAN
    • USP31
    • USP48
    see all
  • Function

    Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquinated proteins. May be involved in the regulation of NF-kappa-B activation by TNF receptor superfamily via its interactions with RELA and TRAF2. May also play a regulatory role at post-synaptic sites.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the peptidase C19 family.
    Contains 3 DUSP domains.
    Contains 1 ubiquitin-like domain.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132691 stained with Coomassie Blue.

References

ab132691 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132691.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up