Description

  • Product name

    Recombinant Human USP5 protein
    See all USP5 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KQEVQAWDGEVRQVSKHAFSLKQLDNPARIPPCGWKCSKCDMRENLWLNL TDGSILCGRRFDGSGGNNHAVEHYRETGYPLAVKLGTITPDGADVYSYDE DDMVLDPSLAEHLSHFGIDMLKMQKTDK
    • Predicted molecular weight

      15 kDa
    • Amino acids

      163 to 291

Specifications

Our Abpromise guarantee covers the use of ab206021 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 10% Glycerol, 0.02% Beta mercaptoethanol, 0.87% Sodium chloride, 0.24% Tris

General Info

  • Alternative names

    • Deubiquitinating enzyme 5
    • Isopeptidase T
    • ISOT
    • ISOT 1
    • Ubiquitin carboxyl-terminal hydrolase 5
    • Ubiquitin isopeptidase T
    • Ubiquitin specific peptidase 5
    • Ubiquitin specific peptidase 5 (isopeptidase T)
    • Ubiquitin specific processing protease 5
    • Ubiquitin specific protease 5 (isopeptidase T)
    • Ubiquitin specific protease 5 (ubiquitin isopeptidase T)
    • Ubiquitin thioesterase 5
    • Ubiquitin thiolesterase 5
    • Ubiquitin-specific-processing protease 5
    • UBP5_HUMAN
    • Usp5
    see all
  • Function

    Cleaves linear and branched multiubiquitin polymers with a marked preference for branched polymers. Involved in unanchored 'Lys-48'-linked polyubiquitin disassembly. Binds linear and 'Lys-63'-linked polyubiquitin with a lower affinity. Knock-down of USP5 causes the accumulation of p53/TP53 and an increase in p53/TP53 transcriptional activity because the unanchored polyubiquitin that accumulates is able to compete with ubiquitinated p53/TP53 but not with MDM2 for proteasomal recognition.
  • Sequence similarities

    Belongs to the peptidase C19 family.
    Contains 2 UBA domains.
    Contains 1 UBP-type zinc finger.
  • Domain

    The UBP-type zinc finger domain interacts selectively with an unmodified C-terminus of the proximal ubiquitin. Both UBA domains are involved in polyubiquitin recognition.
  • Post-translational
    modifications

    The N-terminus is blocked.
  • Information by UniProt

Images

  • SDS-PAGE analysis of 5 μg ab206021. Coomassie-stained

References

ab206021 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206021.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up