Recombinant Human USP6 protein (ab160339)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: WB, ELISA
Description
-
Product name
Recombinant Human USP6 protein -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
DMVENADSLQAQERKDILMKYDKGHRAGLPEDKGPEPVGINSSIDRFGIL HETELPPVTAREAKKIRREMTRTSKWMEMLGEWETYKH -
Amino acids
2 to 89 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab160339 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
ELISA
-
Form
Liquid -
Additional notes
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- Deubiquitinating enzyme 6
- HRP1
- Proto-oncogene TRE-2
see all -
Function
Deubiquitinase with an ATP-independent isopeptidase activity, cleaving at the C-terminus of the ubiquitin moiety. Catalyzes its own deubiquitination. In vitro, isoform 2, but not isoform 3, shows deubiquitinating activity. Promotes plasma membrane localization of ARF6 and selectively regulates ARF6-dependent endocytic protein trafficking. Is able to initiate tumorigenesis by inducing the production of matrix metalloproteinases following NF-kappa-B activation. -
Tissue specificity
Testis specific. Expressed in various cancer cell lines. -
Involvement in disease
Note=A chromosomal aberration involving USP6 is a common genetic feature of aneurysmal bone cyst, a benign osseous neoplasm. Translocation t(16;17)(q22;p13) with CDH11. The translocation generates a fusion gene in which the strong CDH11 promoter is fused to the entire USP6 coding sequence, resulting in USP6 transcriptional up-regulation. -
Sequence similarities
Belongs to the peptidase C19 family.
Contains 1 Rab-GAP TBC domain. -
Domain
The Rab-GAP TBC domain lacks GTPase activator activity but is necessary for interaction with ARF6. -
Post-translational
modificationsMonubiquitinated; ubiquitination is calmodulin and calcium dependent. -
Cellular localization
Cell membrane. Cytoplasm. Endosome. Localizes to the plasma membrane and to filamentous structures within the cell corresponding to ARF6 regulated tubular endosomes. Activation of RAC1 and CDC42 can direct the relocalization of USP6 to the plasma membrane in a manner that depends on the integrity of the actin cytoskeleton. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab160339 has not yet been referenced specifically in any publications.