Description

  • Product name

    Recombinant Human USP9x protein (Catalytic domain)
    See all USP9x proteins and peptides
  • Purity

    = 80 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      TAITTCEALTEWEYLPPVGPRPPKGFVGLKNAGATCYMNSVIQQLYMIPS IRNGILAIEGTGSDVDDDMSGDEKQDNESNVDPRDDVFGYPQQFEDKPAL SKTEDRKEYNIGVLRHLQVIFGHLAASRLQYYVPRGFWKQFRLWGEPVNL REQHDALEFFNSLVDSLDEALKALGHPAMLSKVLGGSFADQKICQGCPHR YECEESFTTLNVDIRNHQNLLDSLEQYVKGDLLEGANAYHCEKCNKKVDT VKRLLIKKLPPVLAIQLKRFDYDWERECAIKFNDYFEFPRELDMEPYTVA GVAKLEGDNVNPESQLIQQSEQSESETAGSTKYRLVGVLVHSGQASGGHY YSYIIQRNGGDGERNRWYKFDDGDVTECKMDDDEEMKNQCFGGEYMGEVF DHMMKRMSYRRQKRWWNAYI LFYERMDTIDQDDELIRYISEL
    • Predicted molecular weight

      51 kDa
    • Amino acids

      1531 to 1972
    • Tags

      GST tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab205998 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.24% Tris, 0.87% Sodium chloride, 0.2% Beta mercaptoethanol, 10% Glycerol

General Info

  • Alternative names

    • Deubiquitinating enzyme FAF X
    • Deubiquitinating enzyme FAF-X
    • DFFRX
    • Drosophila fat facets related X linked
    • FAF
    • Fafl
    • Fam
    • Fat facets homolog
    • Fat facets in mammals
    • Fat facets protein related X linked
    • Fat facets protein related, X-linked
    • Fat facets protein-related
    • hFAM
    • MRX99
    • Probable ubiquitin carboxyl terminal hydrolase FAF X
    • Probable ubiquitin carboxyl-terminal hydrolase FAF-X
    • Ubiquitin carboxyl-terminal hydrolase FAM
    • Ubiquitin specific peptidase 9 X linked
    • Ubiquitin specific peptidase 9, X-linked
    • Ubiquitin specific processing protease FAF X
    • Ubiquitin specific protease 9 X chromosome
    • Ubiquitin thioesterase FAF X
    • Ubiquitin thiolesterase FAF X
    • Ubiquitin thiolesterase FAF-X
    • Ubiquitin-specific protease 9
    • Ubiquitin-specific-processing protease FAF-X
    • USP9 (gene name)
    • Usp9x
    • USP9X_HUMAN
    • Uubiquitin specific protease 9, X chromosome (fat facets like Drosophila)
    • X chromosome
    • X-linked
    see all
  • Function

    Deubiquitinase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. May therefore play an important role regulatory role at the level of protein turnover by preventing degradation of proteins through the removal of conjugated ubiquitin. Essential component of TGF-beta/BMP signaling cascade. Regulates chromosome alignment and segregation in mitosis by regulating the localization of BIRC5/survivin to mitotic centromeres. Specifically hydrolyzes both 'Lys-29'- and 'Lys-33'-linked polyubiquitins chains. Specifically deubiquitinates monoubiquitinated SMAD4, opposing the activity of E3 ubiquitin-protein ligase TRIM33.
  • Tissue specificity

    Widely expressed in embryonic and adult tissues.
  • Sequence similarities

    Belongs to the peptidase C19 family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab205998 (5µg).

References

ab205998 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205998.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up