Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGAQLKKLVDTLP QKPRESIIKLMEKIAQSSLCN
    • Molecular weight
      8 kDa
    • Amino acids
      22 to 91
    • Additional sequence information
      (Homodimeric protein consisting of 142 amino acid residues).

Associated products

Specifications

Our Abpromise guarantee covers the use of ab176042 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >= 98 % SDS-PAGE.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

  • Reconstitution
    Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20oC to -80oC

General Info

  • Alternative names
    • Blastokinin
    • CC10
    • CC16
    • CCPBP
    • CCSP
    • Clara cell phospholipid binding protein
    • Clara cell phospholipid-binding protein
    • Clara cell specific 10 kD protein
    • Clara cells 10 kDa secretory protein
    • OTTHUMP00000236107
    • SCGB1A1
    • Secretoglobin family 1A member 1
    • Secretoglobin, family 1A, member 1 (uteroglobin)
    • UG
    • UGB
    • UP-1
    • UP1
    • Urinary protein 1
    • Urine protein 1
    • UTER_HUMAN
    • Uteroglobin
    see all
  • Function
    Binds phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB) and weakly progesterone, potent inhibitor of phospholipase A2.
  • Tissue specificity
    Clara cells (nonciliated cells of the surface epithelium of the pulmonary airways).
  • Sequence similarities
    Belongs to the secretoglobin family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab176042 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176042.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up