Overview

  • Product name

    Recombinant Human UTP23 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMKITRQKHAKKHLGFFRNNFGVREPYQ ILLDGTFCQAALRGRIQLREQLPRYLMGETQLCTTRCVLKELETLGKDLY GAKLIAQKCQVRNCPHFKNAVSGSECLLSMVEEGNPHHYFVATQDQNLSV KVKKKPGVPLMFIIQNTMVLDKPSPKTIAFVKAVESGQLVSVHEKESIKH LKEEQGLVKNTEQSRRKKRKKISGPNPLSCLKKKKKAPDTQSSASEKKRK RKRIRNRSNPKVLSEKQNAEGE
    • Molecular weight

      31 kDa including tags
    • Amino acids

      1 to 249
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134613 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab134613 is purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 20% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names

    • 1700010I21Rik
    • AI662478
    • BB238373
    • C8orf53
    • D530033C11R
    • MGC14595
    • RGD1307179
    • rRNA processing protein UTP23 homolog
    • rRNA-processing protein UTP23 homolog
    • UTP 23
    • utp23
    • UTP23 small subunit (SSU) processome component homolog (yeast)
    • UTP23_HUMAN
    see all
  • Function

    Involved in rRNA-processing and ribosome biogenesis.
  • Sequence similarities

    Belongs to the UTP23/FCF1 family. UTP23 subfamily.
  • Cellular localization

    Nucleus > nucleolus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab134613.

References

ab134613 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134613.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up