Overview

  • Product name
    Recombinant Human UTP6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAEIIQERIEDRLPELEQLERIGLFSHAEIKAIIKKASDLEYKIQRRTLF KEDFINYVQYEINLLELIQRRRTRIGYSFKKDEIENSIVHRVQGVFQRAS AKWKDDVQLWLSYVAFCKKWATKTRLSKVFSAMLAIHSNKPALWIMAAKW EMEDRLSSESARQLFLRALRFHPECPKLYKEYFRMELMHAEKLRKEKEEF EKASMDVENPDYSEEILKGELAWIIYKNSVSIIKGAEFHVSLLSIAQLFD FAKDLQKEIYDDLQALHTDDPLTWDYVARRELEIESQTEEQPTTKQAKAV EVGRKEERCCAVYEEAVKTLPTEAMWKCYITFCLERFTKKSNSGFLRGKR LERTMTVFRKAHELKLLSECQYKQLSVSLLCYNFLREALEVAVAGTELFR DSGTMWQLKLQVLIESKSPDIAMLFEEAFVHLKPQVCLPLWISWAEWSEG AKSQEDTEAVFKKALLAVIGADSVTLKNKYLDWAYRSGGYKKARAVFKSL QESRPFSVDFFRKMIQFEKEQESCNMANIREYYERALREFGSADSDLWMD YMKEELNHPLGRPENCGQIYWRAMKMLQGESAEAFVAKHAMHQTGHL
    • Amino acids
      1 to 597
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163238 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C17orf40
    • HCA66
    • Hepatocellular carcinoma associated antigen 66
    • Hepatocellular carcinoma-associated antigen 66
    • MHAT
    • Multiple hat domains protein
    • RGD1311017
    • RP23 253E9.3
    • U3 small nucleolar RNA associated protein 6 homolog
    • U3 small nucleolar RNA-associated protein 6 homolog
    • UTP6
    • UTP6, small subunit (SSU) processome component, homolog (yeast)
    • UTP6_HUMAN
    see all
  • Function
    Involved in nucleolar processing of pre-18S ribosomal RNA.
  • Sequence similarities
    Belongs to the UTP6 family.
    Contains 5 HAT repeats.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab163238 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163238 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163238.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up