Overview

  • Product name

    Recombinant Human VAC14 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MNPEKDFAPLTPNIVRALNDKLYEKRKVAALEIEKLVREFVAQNNTVQ IKHVIQTLSQEFALSQHPHSRKGGLIGLAACSIALGKDSGLYLKELIEPV LTCFNDADSRLRYYACEALYNIVKVARGAVLPHFNVLFDGLSKLAADPDP NVKSGSELLDRLLKDIVTESNKFDLVSFIPLLRERIYSNNQYARQFIISW ILVLESVPDINLLDYLPEILDGLFQILGDNGKEIRKMCEVVLGEFLKEIK KNPSSVKFAEMANILVIHCQTTDDLIQLTAMCWMREFIQLAGRVMLPYSS GILTAVLPCLAYDDRKKSIKEVANVCNQSLMKLVTPEDDELDELRPGQRQ AEPTPDDALPKQEGTASGGPDGSCDSSFSSGISVFTAASTERAPVTLHLD GIVQVLNCHLSDTAIGMMTRIAVLKWLYHLYIKTPRKMFRHTDSLFPILL QTLSDESDEVILKDLEVLAEIASSPAGQTDDPGPLDGPDLQASHSELQVP TPGRAGLLNTSGTKGLECSPSTPTMNSYFYKFMINLLKRFSSERKLLEVR GPFIIRQLCLLLNAENIFHSMADILLREEDLKFASTMVHALNTILLTSTE LFQLRNQLKDLKTLESQNLFCCLYRSWCHNPVTTVSLCFLTQNYRHAYDL IQKFGDLEVTVDFLAEVDKLVQLIECPIFTYLRLQLLDVKNNPYLIKALY GLLMLLPQSSAFQLLSHRLQCVPNPELLQTEDSLKAAPKSQKADSPSIDY AELLQHFEKVQNKHLEVRHQRSGRGDHLDRRVVL
    • Molecular weight

      114 kDa including tags
    • Amino acids

      1 to 782

Specifications

Our Abpromise guarantee covers the use of ab132729 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ArPIKfyve
    • FLJ10305
    • FLJ36622
    • FLJ46582
    • MGC149815
    • MGC149816
    • OTTHUMP00000174908
    • Protein VAC14 homolog
    • Tax1 (human T cell leukemia virus type I) binding protein 1
    • Tax1 (human T cell leukemia virus type I) binding protein 2
    • Tax1 binding protein 2
    • Tax1-binding protein 2
    • TAX1BP2
    • TRX
    • VAC 14
    • vac14
    • Vac14 homolog
    • Vac14 homolog (S. cerevisiae)
    • VAC14_HUMAN
    see all
  • Function

    The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol-3,5-bisphosphate (PtdIns(3,5)P2). Acts as a positive activator of PIKfyve kinase activity. Also required to maintain normal levels of phosphatidylinositol 3-phosphate (PtdIns(3)P) and phosphatidylinositol 5-phosphate (PtdIns(5)P). Plays a role in the biogenesis of endosome carrier vesicles (ECV) / multivesicular bodies (MVB) transport intermediates from early endosomes.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the VAC14 family.
    Contains 6 HEAT repeats.
  • Domain

    The C-terminal domain (residues 523-782) mediates homomeric interactions and is necessary for the formation and maintenance of the PI(3,5)P2 regulatory complex.
  • Cellular localization

    Endosome membrane. Microsome membrane. Mainly associated with membranes of the late endocytic pathway.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132729 stained with Coomassie Blue.

References

ab132729 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132729.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up