Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AVRLSNQGFQAYDFPAVTTAQYSFWLYELCDVYLECLKPVLNGVDQVAAE CARQTLYTCLDVGLRLLSPFMPFVTEELFQRLPRRMPQAPPSLCVTPYPE PSECSWKDP
    • Amino acids
      994 to 1102
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159794 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Bat 6
    • Bat6
    • D17H6S56E
    • EC 6.1.1.9
    • G7A
    • Protein G7a
    • SYVC_HUMAN
    • Valine tRNA ligase
    • valine tRNA ligase 1, cytoplasmic
    • Valine--tRNA ligase
    • ValRS
    • VALYL tRNA SYNTHETASE 1
    • valyl tRNA synthetase 2
    • Valyl-tRNA synthetase
    • valyl-tRNA synthetase 2
    • vars
    • Vars1
    • VARS2
    • VARS2, formerly
    see all
  • Sequence similarities
    Belongs to the class-I aminoacyl-tRNA synthetase family.
    Contains 1 GST C-terminal domain.
  • Information by UniProt

Images

  • ab159794 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159794 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159794.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up