Overview

  • Product name
    Recombinant Human VARP protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALYDEDLLKNPFYLALQKCRPDLCSKVAQIHGIVLVPCKGSLSSSIQST CQFESYILIPVEEHFQTLNGKDVFIQGNRIKLGAGFACLLSVPILFEETF YNEKEESFSILCIAHPLEKRESSEEPLAPSDPFSLKTIEDVREFLGRHSE RFDRNIASFHRTFRECERKSLRHHIDSANALYTKCLQQLLRDSHLKMLAK QEAQMNLMKQAVEIYVHHEIYNLIFKYVGTMEASEDAAFNKITRSLQDLQ QKDIGVKPEFSFNIPRAKRELAQLNKCTSPQQKLVCLRKVVQLITQSPSQ RVNLETMCADDLLSVLLYLLVKTEIPNWMANLSYIKNFRFSSLAKDELGY CLTSFEAAIEYIRQGSLSAKPPESEGFGDRLFLKQRMSLLSQMTSSPTDC LFKHIASGNQKEVERLLSQEDHDKDTVQKMCHPLCFCDDCEKLVSGRLND PSVVTPFSRDDRGHTPLHVAAVCGQASLIDLLVSKGAMVNATDYHGATPL HLACQKGYQSVTLLLLHYKASAEVQDNNGNTPLHLACTYGHEDCVKALVY YDVESCRLDIGNEKGDTPLHIAARWGYQGVIETLLQNGASTEIQNRLKET PLKCALNSKILSVMEAYHLSFERRQKSSEAPVQSPQRSVDSISQESSTSS FSSMSASSRQEETKKDYREVEKLLRAVADGDLEMVRYLLEWTEEDLEDAE DTVSAADPEFCHPLCQCPKCAPAQKRLAKVPASGLGVNVTSQDGSSPLHV AALHGRADLIPLLLKHGANAGARNADQAVPLHLACQQGHFQVVKCLLDSN AKPNKKDLSGNTPLIYACSGGHHELVALLLQHGASINASNNKGNTALHEA VIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQVVPSCV ASLDDVAETDRKEYVTVKIRKKWNSKLYDLPDEPFTRQFYFVHSAGQFKG KTSREIMARDRSVPNLTEGSLHEPGRQSVTLRQNNLPAQSGSHAAEKGNS DWPERPGLTQTGPGHRRMLRRHTVEDAVVSQGPEAAGPLSTPQEVSASRS
    • Amino acids
      1 to 1050
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164491 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AA408090
    • Ankrd27
    • Ankyrin repeat domain 27 (VPS9 domain)
    • Ankyrin repeat domain-containing protein 27
    • ANR27_HUMAN
    • BC016493
    • D330003H11Rik
    • DKFZp434L0718
    • FLJ00040
    • MGC25907
    • PP12899
    • VPS9 ankyrin repeat protein
    • VPS9 domain-containing protein
    see all
  • Function
    May be a Rab21 guanine exchange factor and regulate endosome dynamics.
  • Sequence similarities
    Contains 11 ANK repeats.
    Contains 1 VPS9 domain.
  • Cellular localization
    Cytoplasm. Mainly localized to early endosomes in the perinuclear region.
  • Information by UniProt

Images

  • ab164491 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164491 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164491.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up