Description

  • Product name

    Recombinant human VCAM1 protein
    See all VCAM1 proteins and peptides
  • Biological activity

    Measured by the ability of the immobilized protein to support the adhesion of U937 Human histiocytic lymphoma cells. When 5 × 104 cells/well are added to Human VCAM1 coated plates (10 µg/mL with 100 µL/well), >75% cells will adhere after 1 hour incubation at 37°C.

  • Purity

    > 92 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      FKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNGKVTNE GTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPEIHLS GPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLE TKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPK NTVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNA TLTLIAMRMEDSGIYVCEGVNLIGKNRKEVELIVQEKPFTVEISPGPRIA AQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTNSTLTLSPVS FENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSSVTVS CKVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTI EDTGKALVCQAKLHIDDMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSIL EEGSSVNMTCLSQGFPAPKILWSRQLPNGELQPLSENATLTLISTKMEDS GVYLCEGINQAGRSRKEVELIIQVTPKDIKLTAFPSESVKEGDTVIISCT CGNVPETWIILKKKAETGDTVLKSIDGAYTIRKAQLKDAGVYECESKNKV GSQLRSLTLDVQGRENNKDYFSP
    • Predicted molecular weight

      75 kDa including tags
    • Amino acids

      25 to 697
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173991 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    After reconstitution store under sterile conditions for 1 month at 4°C - 8°C or 3 months at -20°C to -80°C. Avoid repeated freeze-thaw cycles.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C. Please see notes section.

    Information available upon request.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 200 µg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • CD106
    • CD106 Antigen
    • INCAM 100
    • INCAM-100
    • L1CAM
    • MGC99561
    • V-CAM 1
    • Vascular Cell Adhesion Molecule 1
    • Vascular cell adhesion protein 1
    • VCAM 1
    • VCAM-1
    • VCAM1
    • VCAM1_HUMAN
    see all
  • Function

    Important in cell-cell recognition. Appears to function in leukocyte-endothelial cell adhesion. Interacts with the beta-1 integrin VLA4 on leukocytes, and mediates both adhesion and signal transduction. The VCAM1/VLA4 interaction may play a pathophysiologic role both in immune responses and in leukocyte emigration to sites of inflammation.
  • Tissue specificity

    Expressed on inflammed vascular endothelium, as well as on macrophage-like and dendritic cell types in both normal and inflammed tissue.
  • Sequence similarities

    Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
  • Domain

    Either the first or the fourth Ig-like C2-type domain is required for VLA4-dependent cell adhesion.
  • Post-translational
    modifications

    Sialoglycoprotein.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • Human VCAM-1, His Tag on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 92%.
  • Immobilized Human VCAM-1, His Tag at 5 µg/mL (100 µL/well) can bind Biotinylated Human ITGA4&ITGB1 Heterodimer Protein, His,Avitag&Tag Free with a linear range of 0.01-0.156 µg/mL.
  • Reduced SDS-PAGE analysis of ab173991, stained overnight with Coomassie Blue.

    Predicted MW of protein with tag is 75 kDa, but DTT-reduced protein migrates as 110-130 kDa due to glycosylation.

References

ab173991 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173991.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up