Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      ADPEFFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSPLNG KVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDP EIHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDAD RKSLETKSLEVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQV YISPKNTVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNGNLQH LSGNATLTLIAMRMEDSGIYVCEGVNLIGKNRKEVELIVQEKPFTVEISP GPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTNSTLT LSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGS SVTVSCKVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMT FIPTIEDTGKALVCQAKLHIDDMEFEPKQRQSTQTLYVNVAPRDTTVLVS PSSILEEGSSVNMTCLSQGFPAPKILWSRQLPNGELQPLSENATLTLIST KMEDSGVYLCEGINQAGRSRKEVELIIQVTPKDIKLTAFPSESVKEGDTV IISCTCGNVPETWIILKKKAETGDTVLKSIDGAYTIRKAQLKDAGVYECE SKNKVGSQLRSLTLDVQGRENNKDYFSPEHHHHHH
    • Molecular weight

      76 kDa including tags
    • Amino acids

      25 to 698
    • Tags

      His tag C-Terminus
    • Additional sequence information

      (NP_001069).

Specifications

Our Abpromise guarantee covers the use of ab219443 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Measured by the ability of the immobilized protein to support the adhesion of U937 Human histiocytic lymphoma cells. When cells are added to VCAM1 coated plates (VCAM1 at 10ug/ml), more than 70% of the cells are adhered. 

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 90 % SDS-PAGE.
    ab219443 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 90% PBS, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • CD106
    • CD106 Antigen
    • INCAM 100
    • INCAM-100
    • L1CAM
    • MGC99561
    • V-CAM 1
    • Vascular Cell Adhesion Molecule 1
    • Vascular cell adhesion protein 1
    • VCAM 1
    • VCAM-1
    • VCAM1
    • VCAM1_HUMAN
    see all
  • Function

    Important in cell-cell recognition. Appears to function in leukocyte-endothelial cell adhesion. Interacts with the beta-1 integrin VLA4 on leukocytes, and mediates both adhesion and signal transduction. The VCAM1/VLA4 interaction may play a pathophysiologic role both in immune responses and in leukocyte emigration to sites of inflammation.
  • Tissue specificity

    Expressed on inflammed vascular endothelium, as well as on macrophage-like and dendritic cell types in both normal and inflammed tissue.
  • Sequence similarities

    Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
  • Domain

    Either the first or the fourth Ig-like C2-type domain is required for VLA4-dependent cell adhesion.
  • Post-translational
    modifications

    Sialoglycoprotein.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab219443 (3µg).   

References

ab219443 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219443.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up