Overview

  • Product name
    Recombinant Human VCIP 135 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QLHNVTAFQGKGHSLGTASGNPHLDPRARETSVVRKHNTGTDFSNSSTKT EPSVFTASSSNSELIRIAPGVVTMRDGRQLDPDLVEAQRKKLQEMVS
    • Amino acids
      1018 to 1114
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164200 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Deubiquitinating protein VCIP135
    • DUBA3
    • KIAA1850
    • Valosin containing protein (p97)/p47 complex interacting protein 1
    • Valosin containing protein p97/p47 complex interacting protein 1
    • Valosin containing protein p97/p47 complex interacting protein p135
    • Valosin-containing protein p97/p47 complex-interacting protein 1
    • Valosin-containing protein p97/p47 complex-interacting protein p135
    • VCIP1_HUMAN
    • VCIP135
    • VCP/p47 complex-interacting 135-kDa protein
    • Vcpip1
    see all
  • Function
    Acts as a deubiquitinating enzyme. Necessary for VCP-mediated reassembly of Golgi stacks after mitosis. May play a role in VCP-mediated formation of transitional endoplasmic reticulum (tER). Mediates dissociation of the ternary complex containing STX5A, NSFL1C and VCP (By similarity). Hydrolyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitin chains.
  • Sequence similarities
    Contains 1 OTU domain.
  • Cellular localization
    Endoplasmic reticulum. Golgi apparatus, Golgi stack. Associated with Golgi stacks and endoplasmic reticulum.
  • Information by UniProt

Images

  • ab164200 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164200 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164200.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up