Recombinant Human VCP protein (BSA and azide free) (ab173074)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQ LFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVI SIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGD IFLVRGGMRAVEFKVVETHPSPYCIVAPDTVIHCEGEPIKREDEEESLNE VGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTG KTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAI IFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRP NSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVA NETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMD DFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHP DKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTM WFGESEANVREIFDKARQAAPCVLFFDELDSIAKA RGGNVEHHHHHH
    • Molecular weight
      67 kDa including tags
    • Amino acids
      1 to 589
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173074 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituent: 0.61% Tris

General Info

  • Alternative names
    • 15S Mg(2+) ATPase p97 subunit
    • 15S Mg(2+)-ATPase p97 subunit
    • ALS14
    • ATPase p97
    • CDC48
    • IBMPFD
    • MGC131997
    • MGC148092
    • MGC8560
    • p97
    • TER ATPase
    • TERA
    • TERA_HUMAN
    • Transitional endoplasmic reticulum ATPase
    • Valosin containing protein
    • Valosin-containing protein
    • VCP
    • Yeast Cdc48p homolog
    see all
  • Function
    Necessary for the fragmentation of Golgi stacks during mitosis and for their reassembly after mitosis. Involved in the formation of the transitional endoplasmic reticulum (tER). The transfer of membranes from the endoplasmic reticulum to the Golgi apparatus occurs via 50-70 nm transition vesicles which derive from part-rough, part-smooth transitional elements of the endoplasmic reticulum (tER). Vesicle budding from the tER is an ATP-dependent process. The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope (By similarity). Regulates E3 ubiquitin-protein ligase activity of RNF19A.
  • Involvement in disease
    Defects in VCP are the cause of inclusion body myopathy with early-onset Paget disease and frontotemporal dementia (IBMPFD) [MIM:167320]; also known as muscular dystrophy, limb-girdle, with Paget disease of bone or pagetoid amyotrophic lateral sclerosis or pagetoid neuroskeletal syndrome or lower motor neuron degeneration with Paget-like bone disease. IBMPFD features adult-onset proximal and distal muscle weakness (clinically resembling limb girdle muscular dystrophy), early-onset Paget disease of bone in most cases and premature frontotemporal dementia.
  • Sequence similarities
    Belongs to the AAA ATPase family.
  • Post-translational
    modifications
    Phosphorylated by tyrosine kinases in response to T-cell antigen receptor activation (By similarity). Phosphorylated upon DNA damage, probably by ATM or ATR.
    ISGylated.
  • Cellular localization
    Cytoplasm > cytosol. Nucleus. Present in the neuronal hyaline inclusion bodies specifically found in motor neurons from amyotrophic lateral sclerosis patients. Present in the Lewy bodies specifically found in neurons from Parkinson disease patients.
  • Information by UniProt

References

ab173074 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173074.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up