Description

  • Product name

    Recombinant Human VDAC1/Porin protein
    See all VDAC1/Porin proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTE TTKVTGSLETKYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFD SSFSPNTGKKNAKIKTGYKREHINLGCDMDFDIAGPSIRGALVLGYEGWL AGYQMNFETAKSRVTQSNFAVGYKTDEFQLHTNVNDGTEFGGSIYQKVNK KLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNSSLIGLGYTQT LKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
    • Predicted molecular weight

      57 kDa including tags
    • Amino acids

      1 to 283
    • Tags

      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132481 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • N2441
    • OMP2
    • POR1
    • hVDAC1
    • MGC111064
    • Mitochondrial Porin
    • Outer mitochondrial membrane protein porin 1
    • Plasmalemmal porin
    • Porin 31HL
    • Porin 31HM
    • VDAC
    • VDAC-1
    • Vdac1
    • VDAC1_HUMAN
    • Voltage dependent anion channel 1
    • Voltage dependent anion selective channel protein 1
    • Voltage-dependent anion-selective channel protein 1
    • YNL055C
    • YNL2441C
    see all
  • Function

    Forms a channel through the mitochondrial outer membrane and also the plasma membrane. The channel at the outer mitochondrial membrane allows diffusion of small hydrophilic molecules; in the plasma membrane it is involved in cell volume regulation and apoptosis. It adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective. May participate in the formation of the permeability transition pore complex (PTPC) responsible for the release of mitochondrial products that triggers apoptosis.
  • Tissue specificity

    Heart, liver and skeletal muscle.
  • Sequence similarities

    Belongs to the eukaryotic mitochondrial porin family.
  • Domain

    Consists mainly of a membrane-spanning beta-barrel formed by 19 beta-strands. The helical N-terminus folds back into the pore opening and plays a role in voltage-gated channel activity.
  • Cellular localization

    Mitochondrion outer membrane. Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132481 stained with Coomassie Blue

References

This product has been referenced in:

  • Aono Y  et al. Sulindac sulfone inhibits the mTORC1 pathway in colon cancer cells by directly targeting voltage-dependent anion channel 1 and 2. Biochem Biophys Res Commun 505:1203-1210 (2018). Read more (PubMed: 30327144) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132481.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up