Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQ LELNERTCRCDKPRR
    • Molecular weight
      38 kDa
    • Amino acids
      27 to 191

Specifications

Our Abpromise guarantee covers the use of ab56620 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Biological Activity: The biological activity is determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 1.0-5.0 ng/ml.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    > 95 % SDS-PAGE.
    > 98% by SDS-PAGE and HPLC analyses. Endotoxin level: < 0.1 ng per µg of VEGF
  • Form
    Lyophilised
  • Additional notes

    < 0.1ng per μg of human VEGF165

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    Preservative: None
    Buffer: None

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in 50 mM acetic acid to a concentration of not less than 50 µg/ml. This solution can then be diluted into other aqueous buffers. For long term storage it is recommended to add at least 0.1% human or BSA.

General Info

  • Alternative names
    • glioma-derived endothelial cell mitogen
    • MGC70609
    • MVCD1
    • Vascular Endothelial Growth Factor
    • Vascular endothelial growth factor A
    • Vascular permeability factor
    • VEGF
    • VEGF-A
    • VEGF165
    • Vegfa
    • VEGFA_HUMAN
    • VPF
    see all
  • Function
    Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth.
  • Tissue specificity
    Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed.
  • Involvement in disease
    Defects in VEGFA are a cause of susceptibility to microvascular complications of diabetes type 1 (MVCD1) [MIM:603933]. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis.
  • Sequence similarities
    Belongs to the PDGF/VEGF growth factor family.
  • Cellular localization
    Secreted. VEGF121 is acidic and freely secreted. VEGF165 is more basic, has heparin-binding properties and, although a signicant proportion remains cell-associated, most is freely secreted. VEGF189 is very basic, it is cell-associated after secretion and is bound avidly by heparin and the extracellular matrix, although it may be released as a soluble form by heparin, heparinase or plasmin.
  • Information by UniProt

Images

References

ab56620 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Answer

Thank you for your inquiry.

I apologize for the confusion. I heard back from the lab that the protein was dialized against 50mM acetic acid and then lyophilized. The lab reconstitutes the VEGF165A in 50mM acetic acid to a concentration of 50µg/ml. This stock is then further diluted with basal medium (EBM, 1.5% FCS) and tested for biological activity by a proliferation assay with HUVEC cells for analysis. However you can also reconstitute the VEGF165A in water to a concentration of 100µg/ml.

I hope this information helps. Please contact us with any other qeustions.

Read More

Answer

Thank you for contacting us.

For the proteins, I would suggest using ab61861 as this protein is arecombinant Human VEGF 165A protein (double, non-glycosylated, polypeptide chain containing 165 amino acids, MW 38kDa, expressed in E.coli).

In terms of the most suitable antibodies, ab9570 which is reactive with VEGF 165and 121, would be the best choice. It was raised against highly pure (>98%) recombinant hVEGF 165 (human Vascular Endothelial Cell Growth Factor), however, the epitope has not been mapped.

As for ab52917 and ab99511, I willcontact the lab to obtain more information about the immunogen region. As soon as I have more details, I will let you know.

What kind of conformation studies are you planning to do? As far as I can tell such application has not been tried with neither these protein nor antibodies.

I hope this information is already of some help to you.
In the meantime, please do not hesitate to contact us if you need any more advice or information.

Read More

Answer

Thank you for contacting us. As you mention, we do have a number of related products available. The SEMA3F products we have in our catalog (such as ab39956) is a rabbit-polyclonal antibody against Semaphorin 3F. It is guaranteed to work with mouse and rat samples in Western blot (WB) and immunohistochemistry on PFA perfusion fixed frozen sections (IHC-FoFr). Semaphorins may play a role in cell motility; you may find more information about the target under the SwissProtID Q13275 (http://www.uniprot.org/uniprot/Q13275). The Semaphorin 3F peptide that is available under catalog number ab39955 is the immunogen that was used to generate the above antibody. This peptide can be used to block the signal detected by the antibody and thus helps to assess the specificity of the detection. https://www.abcam.com/index.html?datasheet=39955 https://www.abcam.com/index.html?datasheet=39955. https://www.abcam.com/index.html?datasheet=39956 https://www.abcam.com/index.html?datasheet=39956. We also have some VEGF165 proteins such as ab56620 and ab89574 in our catalog. These products are the actual Vascular endothelial growth factors (isoform A). You may find more detailed information on these growth factors for example under the SwissProtID P15692 (http://www.uniprot.org/uniprot/P15692). I would also encourage you to consult the latest literature available through PubMed and other resources in order to find the most up-to-date information about this specific research interest. The difference between the various catalog numbers may be that some of them are active proteins that can be used in functional studies, compared to others that have not been tested and cannot be guaranteed to work. https://www.abcam.com/index.html?datasheet=56620 https://www.abcam.com/index.html?datasheet=56620. https://www.abcam.com/index.html?datasheet=89574 https://www.abcam.com/index.html?datasheet=89574. Among our products we also have a number of antibodies against the various VEGF165 isoforms available, such as ab69479. These antibodies detect the protein of the species stated on the datasheet and are guaranteed to work in the mentioned applications. https://www.abcam.com/index.html?datasheet=69479 https://www.abcam.com/index.html?datasheet=69479. In general, all tested species and applications are specified on our datasheets, which are updated as soon as any new information is brought to our attention. If you decide to use one of our products in a species or application that has not been tested, please contact our Scientific Support team prior to the purchase as you might be eligible for our testing discount program. I am pleased to let you know that you are covered by our Abpromise should you decide to purchase one of our products: We will happily offer technical support and in the event that a product is not functioning in the applications cited on the product data sheet (and the problem has been reported within 6 months of purchase), we will be pleased to provide a credit note, free of charge replacement or refund. The delivery time depends on the product and if we have it in stock. As you can see at the top of each datasheet, the above mentioned products are currently available and if you order now you can get it tomorrow. I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up