Recombinant human VEGF 165A protein (Active) (Biotin) (ab168684)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
Achieve higher consistency and quality standards with a premium grade bioactive protein
- High batch-to-batch consistency
- Optimal bioactivity
- Guaranteed identical to human native proteins
- >95% purity
- Ultra-low endotoxin levels: <0.005 Eu/µg
- Carrier and tag free
Description
-
Product name
Recombinant human VEGF 165A protein (Active) (Biotin)
See all VEGF 165A proteins and peptides -
Biological activity
The bio-activity was determined by dose-dependent stimulation of the proliferation of HUVEC cells.
ED 50: 2X105 Unit/mg.
-
Purity
> 95 % SDS-PAGE.
Purified by ion exchnage chromatography + Label -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQ LELNERTCRCDKPRR -
Predicted molecular weight
19 kDa -
Amino acids
27 to 191
-
-
Conjugation
Biotin
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab168684 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
A standard biotin reagent (13.5 angstroms) is used in this product.
Biotin:Protein ratio The biotin to protein ratio is 3-5 as determined by the HABA assay.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: PBS, 5% Trehalose
Lyophilized from 0.22 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 100 µg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing.
General Info
-
Alternative names
- glioma-derived endothelial cell mitogen
- MGC70609
- MVCD1
see all -
Function
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. -
Tissue specificity
Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed. -
Involvement in disease
Defects in VEGFA are a cause of susceptibility to microvascular complications of diabetes type 1 (MVCD1) [MIM:603933]. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. -
Sequence similarities
Belongs to the PDGF/VEGF growth factor family. -
Cellular localization
Secreted. VEGF121 is acidic and freely secreted. VEGF165 is more basic, has heparin-binding properties and, although a signicant proportion remains cell-associated, most is freely secreted. VEGF189 is very basic, it is cell-associated after secretion and is bound avidly by heparin and the extracellular matrix, although it may be released as a soluble form by heparin, heparinase or plasmin. - Information by UniProt
Images
-
Immobilized human VEGFR1/R2, Fc tag at 2μg/mL (100 μL/well) binds ab168684.
Linear range: 0.39-3.1 ng/mL (QC tested).
-
Immobilized Human Neuropilin-1, His Tag at 2 μg/mL (100 μL/well) binds ab168684.
Linear range: 5-40 ng/mL (Routinely tested).
-
Immobilized Anti-VEGF MAb,Human IgG1 (Avastin) at 5μg/mL (100 μL/well) binds ab168684.
Linear range: 0.24-1.95 ng/mL (Routinely tested).
-
Reduced (Lane 1) and non-reduced (Lane 2) ab168684 on SDS-PAGE, stained overnight with Coomassie Blue.
Purity of protein >95%.
As a result of glycosylation, the protein migrates as 25-30 kDa (monomer) under reducing condition, and 43-50 kDa under non-reducing condition.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab168684 has not yet been referenced specifically in any publications.