Description

  • Product name

    Recombinant human VEGF Receptor 1 protein
    See all VEGF Receptor 1 proteins and peptides
  • Biological activity

    The activity of sVEGFR-1 was determined by its ability to inhibit the VEGF-A-induced proliferation of HUVECs.

  • Purity

    > 90 % SDS-PAGE.
    Purified protein was visualised by Silver stain.
  • Expression system

    Insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERL SITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAI YIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPL DTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHR QTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNK RASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNT SVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVKAFPSPEVVWLKDGL PATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTATLIV NVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHN HSEARCDFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVV ADSRISGIYICIASNKVGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLK LSCTVNKFLYRDVTWILLRTVNNRTMHYSISKQKMAITKEHSITLNLTIM NVSLQDSGTYACRARNVYTGEEILQKKEITIRGEHCNKKAVFSRISKFKS TRNDCTTQSNVKH
    • Amino acids

      25 to 688
    • Additional sequence information

      VEGF Receptor 1 isoform 2 without the signal peptide

Specifications

Our Abpromise guarantee covers the use of ab54346 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    The lyophilized sVEGFR-1 is soluble in water and most aqueous buffers.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Buffer: None
    Endotoxin level:< 0.1 ng per µg of sVEGFR1

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    This protein should be reconstituted in PBS to a concentration not lower than 100 ng/ml.

General Info

  • Alternative names

    • EC 2.7.10.1
    • FLT
    • FLT 1
    • Flt-1
    • FLT1
    • Fms like tyrosine kinase 1
    • Fms related tyrosine kinase 1
    • Fms related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor)
    • Fms related tyrosine kinase 1 vascular endothelial growth factor/vascular permeability factor receptor
    • Fms-like tyrosine kinase 1
    • FRT
    • Soluble VEGF receptor 1 14
    • Soluble VEGFR1 variant 2
    • Soluble VEGFR1 variant 21
    • Tyrosine protein kinase FRT
    • Tyrosine protein kinase receptor FLT
    • Tyrosine-protein kinase FRT
    • Tyrosine-protein kinase receptor FLT
    • Vascular endothelial growth factor receptor 1
    • Vascular endothelial growth factor vascular permeability factor receptor
    • Vascular permeability factor receptor
    • Vascular permeability factor receptor 1
    • VEGFR 1
    • VEGFR-1
    • VEGFR1
    • VGFR1_HUMAN
    see all
  • Function

    Receptor for VEGF, VEGFB and PGF. Has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. Isoform SFlt1 may have an inhibitory role in angiogenesis.
  • Tissue specificity

    Mostly in normal lung, but also in placenta, liver, kidney, heart and brain tissues. Specifically expressed in most of the vascular endothelial cells, and also expressed in peripheral blood monocytes. Isoform sFlt1 is strongly expressed in placenta.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • FLT-1 Sandwich-ELISA using recombinant human soluble FLT-1 as standard. Mouse anti-human FLT-1 was used as capture antibody, Biotinylated rabbit anti-human FLT-1 was used for detection.

  • SDS-PAGE analysis of recombinant human soluble VEGFR-1 produced in insect cells. Sample was loaded in 15% SDS-polyacrylamide gel under reducing condition and stained with Coomassie stain.
  • Inhibition of the VEGF165-induced proliferation in HUVECs by soluble VEGFR-1/Flt-1. VEGF165 (10ng/ml) was preincubated with increasing amounts of sVEGFR-1/Flt-1 for 1h and then added to the cells.

References

ab54346 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab54346.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up