For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    recombinant-human-vegf-receptor-1-protein-active-ab216987.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Angiogenesis Growth Factors VEGF VEGF Receptors
Share by email
Bioactive grade

Recombinant human VEGF Receptor 1 protein (Active) (ab216987)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Functional Studies - Recombinant human VEGF Receptor 1 protein (Active) (ab216987)
  • SDS-PAGE - Recombinant human VEGF Receptor 1 protein (Active) (ab216987)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 95% SDS-PAGE
  • Endotoxin level: < 1.000 Eu/µg
  • Active: Yes
  • Tags: His tag C-Terminus
  • Suitable for: SDS-PAGE, Functional Studies

You may also be interested in

ELISA
Product image
Human soluble TREM1 ELISA Kit (ab185987)
ELISA
Product image
Human VEGF R1 ELISA Kit (FLT1) (ab195210)

View more associated products

Description

  • Product name

    Recombinant human VEGF Receptor 1 protein (Active)
    See all VEGF Receptor 1 proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized Human VEGF165 at 2 μg/mL can bind ab216987 with a linear range of 3-50 ng/mL.

    Measured by its ability to bind Human VEGF165  in the SPR assay with an estimated KD of 0.1nM.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

    P17948
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSI TKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYI FISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDT LIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQT NTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRA SVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSV HIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVKAFPSPEVVWLKDGLPA TEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTATLIVNV KPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHS EARCDFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVAD SRISGIYICIASNKVGTVGRNISFYITDVPNGFHVNLEKM PTEGEDLK LSCTVNKFLYRDVTWILLRTVNNRTMHYSISKQKMAITKEHSITLNLTIM NVSLQDSGTYACRARNVYTGEEILQKKEITIRDQEAPYLLRNLSDHTVAI SSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIERVTEE DEGVYHCKATNQKGSVESSAYLTVQGTSDKSN
    • Predicted molecular weight

      83 kDa including tags
    • Amino acids

      27 to 756
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_002010.1.

Associated products

  • Related Products

    • Anti-6X His tag® antibody [HIS.H8] (ab18184)
    • Anti-6X His tag® antibody [4D11] (ab5000)
    • Anti-6X His tag® antibody (ab9108)

Specifications

Our Abpromise guarantee covers the use of ab216987 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilized
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 97% PBS

    Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with sterile deionized water to a concentration of 200 µg/ml.

General Info

  • Alternative names

    • EC 2.7.10.1
    • FLT
    • FLT 1
    • Flt-1
    • FLT1
    • Fms like tyrosine kinase 1
    • Fms related tyrosine kinase 1
    • Fms related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor)
    • Fms related tyrosine kinase 1 vascular endothelial growth factor/vascular permeability factor receptor
    • Fms-like tyrosine kinase 1
    • FRT
    • Soluble VEGF receptor 1 14
    • Soluble VEGFR1 variant 2
    • Soluble VEGFR1 variant 21
    • Tyrosine protein kinase FRT
    • Tyrosine protein kinase receptor FLT
    • Tyrosine-protein kinase FRT
    • Tyrosine-protein kinase receptor FLT
    • Vascular endothelial growth factor receptor 1
    • Vascular endothelial growth factor vascular permeability factor receptor
    • Vascular permeability factor receptor
    • Vascular permeability factor receptor 1
    • VEGFR 1
    • VEGFR-1
    • VEGFR1
    • VGFR1_HUMAN
    see all
  • Function

    Receptor for VEGF, VEGFB and PGF. Has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. Isoform SFlt1 may have an inhibitory role in angiogenesis.
  • Tissue specificity

    Mostly in normal lung, but also in placenta, liver, kidney, heart and brain tissues. Specifically expressed in most of the vascular endothelial cells, and also expressed in peripheral blood monocytes. Isoform sFlt1 is strongly expressed in placenta.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Cellular localization

    Secreted and Cell membrane.
  • Target information above from: UniProt accession P17948 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • Functional Studies - Recombinant human VEGF Receptor 1 protein (Active) (ab216987)
    Functional Studies - Recombinant human VEGF Receptor 1 protein (Active) (ab216987)

    Immobilized Human VEGF165, Tag Free (ab155740) at 0.01 μg/mL (100 μL/well) can bind ab216987 with a linear range of 4-31 ng/mL

  • SDS-PAGE - Recombinant human VEGF Receptor 1 protein (Active) (ab216987)
    SDS-PAGE - Recombinant human VEGF Receptor 1 protein (Active) (ab216987)

    SDS-PAGE analysis of reduced ab216987 stained overnight with Coomassie Blue.

    Note: The reducing protein migrates as 115-125 kDa on a SDS-PAGE gel under reducing condition due to glycosylation..

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab216987? Please let us know so that we can cite the reference in this datasheet.

    ab216987 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab216987.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.