Description

  • Product name

    Recombinant Human VEGF Receptor 2 protein (Fc Chimera His Tag)
    See all VEGF Receptor 2 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNN QSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYV YVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYP EKRFVPDGNRISWDSKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIV VVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSK HQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTK KNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPPEIKWYK NGIPLESNHTIKAGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLV VYVPPQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEEC ANEPSQAVSVTNPYPCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVST LVIQAANVSALYKCEAVNKVGRGERVISFHVTRGPEITLQPDMQPTEQES VSLWCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKLNATM FSNSTNDILIMELKNASLQDQGDYVCLAQDRKTKKRHCVVRQLTVLERVA PTITGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLK DGNRNLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLELE PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDV SHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
    • Predicted molecular weight

      111 kDa including tags
    • Amino acids

      20 to 764
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain fused to hlgG-His-tag at C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab223002 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • CD309
    • CD309 antigen
    • EC 2.7.10.1
    • Fetal liver kinase 1
    • FLK-1
    • FLK1
    • FLK1, mouse, homolog of
    • Kdr
    • Kinase insert domain receptor
    • Kinase insert domain receptor (a type III receptor tyrosine kinase)
    • KRD1
    • Ly73
    • Protein tyrosine kinase receptor FLK1
    • Protein-tyrosine kinase receptor flk-1
    • soluble VEGFR2
    • Tyrosine kinase growth factor receptor
    • Vascular endothelial growth factor receptor 2
    • VEGFR
    • VEGFR 2
    • VEGFR-2
    • VEGFR2
    • VGFR2_HUMAN
    see all
  • Function

    Receptor for VEGF or VEGFC. Has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions.
  • Involvement in disease

    Defects in KDR are associated with susceptibility to hemangioma capillary infantile (HCI) [MIM:602089]. HCI are benign, highly proliferative lesions involving aberrant localized growth of capillary endothelium. They are the most common tumor of infancy, occurring in up to 10% of all births. Hemangiomas tend to appear shortly after birth and show rapid neonatal growth for up to 12 months characterized by endothelial hypercellularity and increased numbers of mast cells. This phase is followed by slow involution at a rate of about 10% per year and replacement by fibrofatty stroma.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 7 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Phosphorylated. Dephosphorylated by PTPRB. Dephosphorylated by PTPRJ at Tyr-951, Tyr-996, Tyr-1054, Tyr-1059, Tyr-1175 and Tyr-1214.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 3 µg of ab223002 analyzed by 15% SDS-PAGE.

References

ab223002 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223002.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up