Recombinant human VEGF189 protein (ab106307)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Endotoxin level: < 0.100 Eu/µg
- Active: Yes
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human VEGF189 protein -
Biological activity
Measured by the stimulation of cell proliferation in human umbilical vein endothelial cells in the range of 2-20 ng/ml.
-
Purity
> 98 % SDS-PAGE.
Gel filtration, purification via Uno S6 -
Endotoxin level
< 0.100 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKH LFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR -
Predicted molecular weight
42 kDa -
Amino acids
27 to 232 -
Additional sequence information
Mature protein without signal peptide.
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab106307 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Additional notes
Molecular weight: ~42 kDa (Dimer)
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.
Constituent: 0.3% Acetic acid
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionShould be reconstituted in PBS or medium containing at least 0.1% human or bovine serum albumin to a concentration not lower than 50 µg/ml.
General Info
-
Alternative names
- MGC70609
- MVCD1
- Vascular endothelial growth factor A
see all -
Function
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. -
Tissue specificity
Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed. -
Involvement in disease
Defects in VEGFA are a cause of susceptibility to microvascular complications of diabetes type 1 (MVCD1) [MIM:603933]. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. -
Sequence similarities
Belongs to the PDGF/VEGF growth factor family. -
Cellular localization
Secreted. VEGF121 is acidic and freely secreted. VEGF165 is more basic, has heparin-binding properties and, although a signicant proportion remains cell-associated, most is freely secreted. VEGF189 is very basic, it is cell-associated after secretion and is bound avidly by heparin and the extracellular matrix, although it may be released as a soluble form by heparin, heparinase or plasmin. - Information by UniProt
Images
-
VEGF-A Sandwich-ELISA using VEGF189 as standard. Mouse anti-human VEGF-A was used as capture antibody, Biotinylated mouse anti-human VEGF-A was used for detection.
-
SDS-PAGE analysis of recombinant human VEGF-A isoforms produced in E. coli. Samples were loaded under non-reducing conditions in 15% SDS-polyacrylamide gel and stained with Silver stain.
-
VEGF189-induced proliferation of primary human dermal lymphatic endothelial cells (HDLEC). HDLECs were stimulated with increasing amounts of recombinant human VEGF189.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (2)
ab106307 has been referenced in 2 publications.
- Patel N et al. Monitoring response to anti-angiogenic mTOR inhibitor therapy in vivo using 111In-bevacizumab. EJNMMI Res 7:49 (2017). WB . PubMed: 28560583
- Hettema W et al. A randomized, single-blind, Phase I trial (INVICTAN-1) assessing the bioequivalence and safety of BI 695502, a bevacizumab biosimilar candidate, in healthy subjects. Expert Opin Investig Drugs 26:889-896 (2017). PubMed: 28651442