Description

  • Product name

    Recombinant human VEGF189 protein
  • Biological activity

    Measured by the stimulation of cell proliferation in human umbilical vein endothelial cells in the range of 2-20 ng/ml.

  • Purity

    > 98 % SDS-PAGE.
    Visualised by silver stain.
  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKH LFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
    • Predicted molecular weight

      42 kDa
    • Amino acids

      27 to 232
    • Additional sequence information

      Mature protein without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab106307 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    Constituent: 0.3% Acetic acid

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Should be reconstituted in PBS or medium containing at least 0.1% human or bovine serum albumin to a concentration not lower than 50 µg/ml.

General Info

  • Alternative names

    • MGC70609
    • MVCD1
    • Vascular endothelial growth factor A
    • Vascular permeability factor
    • VEGF
    • VEGF-A
    • Vegfa
    • VEGFA_HUMAN
    • VPF
    see all
  • Function

    Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth.
  • Tissue specificity

    Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed.
  • Involvement in disease

    Defects in VEGFA are a cause of susceptibility to microvascular complications of diabetes type 1 (MVCD1) [MIM:603933]. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis.
  • Sequence similarities

    Belongs to the PDGF/VEGF growth factor family.
  • Cellular localization

    Secreted. VEGF121 is acidic and freely secreted. VEGF165 is more basic, has heparin-binding properties and, although a signicant proportion remains cell-associated, most is freely secreted. VEGF189 is very basic, it is cell-associated after secretion and is bound avidly by heparin and the extracellular matrix, although it may be released as a soluble form by heparin, heparinase or plasmin.
  • Information by UniProt

Images

  • VEGF-A Sandwich-ELISA using VEGF189 as standard. Mouse anti-human VEGF-A was used as capture antibody, Biotinylated mouse anti-human VEGF-A was used for detection.

  • SDS-PAGE analysis of recombinant human VEGF-A isoforms produced in E. coli. Samples were loaded under non-reducing conditions in 15% SDS-polyacrylamide gel and stained with Silver stain.
  • VEGF189-induced proliferation of primary human dermal lymphatic endothelial cells (HDLEC). HDLECs were stimulated with increasing amounts of recombinant human VEGF189.

References

This product has been referenced in:

  • Patel N  et al. Monitoring response to anti-angiogenic mTOR inhibitor therapy in vivo using 111In-bevacizumab. EJNMMI Res 7:49 (2017). WB . Read more (PubMed: 28560583) »
See 1 Publication for this product

Customer reviews and Q&As

Answer

Ab58953:
Amino acids 26-530 of UniProt Q5DT02
GKLLV VPMDGSHWFT MQSVVEKLIL RGHEVVVVMP EVSWQLERSL NCTVKTYSTS YTLEDQNREF MVFAHAQWKA QAQSIFSLLM SSSSGFLDLF FSHCRSLFND RKLVEYLKES SFDAVFLDPF DTCGLIVAKY FSLPSVVFTR GIFCHHLEEG AQCPAPLSYV PNDLLGFSDA MTFKERVWNH IVHLEDHLFC QYLFRNALEI ASEILQTPVT AYDLYSHTSI WLLRTDFVLD YPKPVMPNMI FIGGINCHQG KPLPMEFEAY INASGEHGIV VFSLGSMVSE IPEKKAMAIA DALGKIPQTV LWRYTGTRPS NLANNTILVK WLPQNDLLGH PMTRAFITHA GSHGVYESIC NGVPMVMMPL FGDQMDNAKR METKGAGVTL NVLEMTSEDL ENALKAVIND KSYKENIMRL SSLHKDRPVE PLDLAVFWVE FVMRHKGAPH LRPAAHDLTW YQYHSLDVIG FLLAVVLTVA FITFKCCAYG YRKCLGKKGR VKKAHKSKTH


Ab106307:
Amino acids 27-215 of UniProt P15692
APMA EGGGQNHHEV VKFMDVYQRS YCHPIETLVD IFQEYPDEIE YIFKPSCVPL MRCGGCCNDE GLECVPTEES NITMQIMRIK PHQGQHIGEM SFLQHNKCEC RPKKDRARQE KKSVRGKGKG QKRKRKKSRY KSWSVYVGAR CCLMPWSLPG PHPCGPCSER RKHLFVQDPQ TCKCSCKNTD SRCKA


Ab123452:
Amino acids 1-354 of UniProt P00480
MLFNLRILLN NAAFRNGHNF MVRNFRCGQP LQNKVQLKGR DLLTLKNFTG EEIKYMLWLS ADLKFRIKQK GEYLPLLQGK SLGMIFEKRS TRTRLSTETG FALLGGHPCF LTTQDIHLGV NESLTDTARV LSSMADAVLA RVYKQSDLDT LAKEASIPII NGLSDLYHPI QILADYLTLQ EHYSSLKGLT LSWIGDGNNI LHSIMMSAAK FGMHLQAATP KGYEPDASVT KLAEQYAKEN GTKLLLTNDP LEAAHGGNVL ITDTWISMGQ EEEKKKRLQA FQGYQVTMKT AKVAASDWTF LHCLPRKPEE VDDEVFYSPR SLVFPEAENR KWTIMAVMVS LLTDYSPQLQ KPKF

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up