For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

Hello. We're improving abcam.com and we'd welcome your feedback.

Hello. We're improving abcam.com and we'd welcome your feedback.

Infomation icon

We haven't added this to the BETA yet

New BETA website

New BETA website

Hello. We're improving abcam.com and we'd welcome your feedback.

Take a look at our BETA site and see what we’ve done so far.

Switch on our new BETA site

Now available

Search and browse selected products

  • A selection of primary antibodies

Purchase these through your usual distributor

In the coming months

  • Additional product types
  • Supporting content
  • Sign in to your account
  • Purchase online
United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Customized Products & Partnerships
    Customized Products & Partnerships

    Customized products and commercial partnerships to accelerate your diagnostic and therapeutic programs.

    Customized products

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    recombinant-human-vegfa-protein-ab55566.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Angiogenesis Growth Factors VEGF VEGF
Share by email

Recombinant Human VEGFA protein (ab55566)

  • Datasheet
  • SDS
Reviews (1)Q&A (7)References (5)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Shipping info

Promotion Information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant Human VEGFA protein (ab55566)

    Key features and details

    • Expression system: Escherichia coli
    • Purity: > 95% SDS-PAGE
    • Tags: His tag N-Terminus
    • Suitable for: SDS-PAGE, WB

    You may also be interested in

    Protein
    Product image
    Recombinant human VEGFC protein (ab155739)
    ELISA
    Product image
    Human VEGF ELISA Kit (ab222510)
    Primary
    Product image
    Anti-VEGFA antibody [EP1176Y] - C-terminal (ab52917)

    View more associated products

    Description

    • Product name

      Recombinant Human VEGFA protein
      See all VEGFA proteins and peptides
    • Purity

      > 95 % SDS-PAGE.
      Proprietary purification method
    • Expression system

      Escherichia coli
    • Accession

      P15692-4
    • Protein length

      Full length protein
    • Animal free

      No
    • Nature

      Recombinant
      • Species

        Human
      • Sequence

        APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPPQGQHIGEMSFLQHN KCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQ LELNERTCRCDKPRR
      • Actual molecular weight

        24 kDa including tags
      • Amino acids

        27 to 191
      • Tags

        His tag N-Terminus
      • Additional sequence information

        This recombinant VEGF protein comprises a 165 amino acid fragment (27-191) corresponding to the VEGF 165 isoform and is expressed in E. coli with an aminoterminal hexahistidine tag.

    Associated products

    • Related Products

      • Human VEGF ELISA Kit (ab100662)
      • Human VEGF ELISA Kit (ab100663)
      • Anti-VEGFA antibody [VG-1] (ab1316)
      • Anti-VEGFA antibody (ab46154)
      • Anti-VEGFA antibody [EP1176Y] - C-terminal (ab52917)

    Specifications

    Our Abpromise guarantee covers the use of ab55566 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

      Western blot

    • Form

      Liquid
    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

      pH: 8.00
      Constituents: 0.242% Tris, 50% Glycerol

    General Info

    • Alternative names

      • Folliculostellate cell-derived growth factor
      • Glioma-derived endothelial cell mitogen
      • MGC70609
      • MVCD1
      • vascular endothelial growth factor
      • Vascular endothelial growth factor A
      • vascular endothelial growth factor A121
      • vascular endothelial growth factor A165
      • Vascular permeability factor
      • Vegf
      • VEGF A
      • VEGF-A
      • VEGF120
      • Vegfa
      • VEGFA_HUMAN
      • VPF
      see all
    • Function

      Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth.
    • Tissue specificity

      Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed.
    • Involvement in disease

      Defects in VEGFA are a cause of susceptibility to microvascular complications of diabetes type 1 (MVCD1) [MIM:603933]. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis.
    • Sequence similarities

      Belongs to the PDGF/VEGF growth factor family.
    • Cellular localization

      Secreted. VEGF121 is acidic and freely secreted. VEGF165 is more basic, has heparin-binding properties and, although a signicant proportion remains cell-associated, most is freely secreted. VEGF189 is very basic, it is cell-associated after secretion and is bound avidly by heparin and the extracellular matrix, although it may be released as a soluble form by heparin, heparinase or plasmin.
    • Target information above from: UniProt accession P15692 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Images

    • SDS-PAGE - Recombinant Human VEGFA protein (ab55566)
      SDS-PAGE - Recombinant Human VEGFA protein (ab55566)
      ab55566 on SDS-PAGE

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (5)

    Publishing research using ab55566? Please let us know so that we can cite the reference in this datasheet.

    ab55566 has been referenced in 5 publications.

    • Tsakiroglou P  et al. Angiogenesis is Differentially Modulated by Anthocyanin and Phenolic Acid Extracts from Wild Blueberry (V. angustifolium) Through PI3K Pathway. J Med Food N/A:N/A (2020). PubMed: 32614624
    • Liu X  et al. Fruquintinib inhibits VEGF/VEGFR2 axis of choroidal endothelial cells and M1-type macrophages to protect against mouse laser-induced choroidal neovascularization. Cell Death Dis 11:1016 (2020). PubMed: 33247124
    • Xiao T  et al. Polyphyllin I suppresses the formation of vasculogenic mimicry via Twist1/VE-cadherin pathway. Cell Death Dis 9:906 (2018). PubMed: 30185783
    • Hunter RK  et al. Adipose-Derived Stromal Vascular Fraction Cell Effects on a Rodent Model of Thin Endometrium. PLoS One 10:e0144823 (2015). WB . PubMed: 26657744
    • Mannell HK  et al. ARNO regulates VEGF-dependent tissue responses by stabilizing endothelial VEGFR-2 surface expression. Cardiovasc Res 93:111-9 (2012). PubMed: 22002459

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-8 of 8 Abreviews or Q&A

    Works Perfect

    Excellent
    Abreviews
    Abreviews
    Application
    Western blot
    very clean results.

    Abcam user community

    Verified customer

    Submitted Jul 14 2021

    Question

    If the notes refer to the full length of protein, what the phosphorylation status of this product ab42614?

    Read More

    Abcam community

    Verified customer

    Asked on Apr 25 2012

    Answer

    I am sorry my previous email was unclear.

    The phosphorylation status of ab42614 is no known. This is not something that is determined during the production process.

    I hope this information is helpful.

    Read More

    Abcam Scientific Support

    Answered on Apr 25 2012

    Question



    Thank you very much for your great suggestion. This product is perfect except the Agarose beads. Because we will use the centrifuge to separate the particle, the

    rigidity ofAgarose may be not enough. However, I got very useful information from your email that I can use the polyclonal anti-GST antibody to fish out the GST-

    tagged VEGFR protein. It is very important information for me. Thank you very much.



    And another simple question is the phosphorylation of the product ab42614. From the datasheet, it says that ab42614 is “Phosphorylated. Dephosphorylated by

    PTPRB. Dephosphorylated by PTPRJ at Tyr-951, Tyr-996, Tyr-1054, Tyr-1059, Tyr-1175 and Tyr-1214”.



    1, I just want to make sure whether all the 6 Tyrosine positions (Tyr-951, Tyr-996, Tyr-1054, Tyr-1059, Tyr-1175 and Tyr-1214) are phosphorylated.



    2, For the dephosphorylation, there are two products mentioned “PTPRB” and “PTPRJ”. I’d like to do the dephosphorylation at Tyr-951, Tyr-996, Tyr-1054, Tyr-

    1059, Tyr-1175 and Tyr-1214, which item should I choose?

    Read More

    Abcam community

    Verified customer

    Asked on Apr 24 2012

    Answer

    Thank you for your reply.

    Actually it is fine to centrifuge agarose beads. Typically for IP I have centrifuged agarose beads at 500xg for 3-5 min at 4 degrees C.

    Regarding your questions 1 and 2, those notes on the datasheet for ab42614 are general notes that just refer to the biochemical properties of the full length protein.

    I hope this is helpful. Please feel free to contact me if you have further questions.

    Read More

    Abcam Scientific Support

    Answered on Apr 24 2012

    Question

    Sorry to interrupt you again. I really got some further questions.



    Actually, I want to choose an Anti-GST antibody as a “bait” to fish out the GST-tagged VEGFR. For the bait, I hope to immobilize the antibody to some particles. I find some Anti-GST antibody (Biotin) products on your website that I’m interested. My questions are:



    1, What kind of GST-tag (ab42614) it belongs to, human, rabbit, goat or sth.? May I use the anti-GST antibody to immuno- fish out that GST-tagged VEGFR?



    2, I found that all the Anti-GST antibody (Biotin) products on your websites are polyclonal. How about the immuno-affinity of polyclonal antibody to GST compared to the monoclonal one? May I use the polyclonal bait to fish out the GST-tagged VEGFR?



    3, I’d like to use the biotin-group of Anti-GST antibody for its immobilization. Is it possible to use a streptavidin-modified particle to immobilize the Anti-GST antibody (Biotin)?



    Sorry for asking so many questions. I’m looking forward your professional suggestions.

    Read More

    Abcam community

    Verified customer

    Asked on Apr 23 2012

    Answer

    Thank you for your enquiry.

    I think I have found a product that will suit your needs:

    https://www.abcam.com/GST-antibody-Agarose-ab90667.html

    This is anti-GST antibody covalently linked to agarose beads. Using this product would save you additional steps of first finding an anti-GST antibody and then locating an appropriate support.

    I hope this is helpful. Please let me know if you have any further questions!

    Read More

    Abcam Scientific Support

    Answered on Apr 23 2012

    Question


    Thanks a lot for your useful information. I appreciate it very much.

    Read More

    Abcam community

    Verified customer

    Asked on Apr 20 2012

    Answer

    I'm happy to help! Please contact me again if you need anything further.

    Read More

    Abcam Scientific Support

    Answered on Apr 20 2012

    Question

    Hi,



    I’m sorry to interrupt you. I have some questions about your product.



    We just bought a VEGF Receptor 2 protein (Tagged) (ab42614) from your company. However, we can’t find the Tag information from the website. Because we want to utilize the tag for our further research, I just wonder what kind of tag is used for this protein.



    I noticed another product we bought VEGF protein (His tag) (ab55566) giving the tag information. Could you help me to check what kind of proprietary tag of the ab42614 ?



    Thank you for your great help!

    Read More

    Abcam community

    Verified customer

    Asked on Apr 20 2012

    Answer

    Thank you for your enquiry.

    VEGF Receptor 2 protein (Tagged) (ab42614) contains an N-terminal GST tag.

    I hope this is helpful. Please contact me again if you have any further questions.

    Read More

    Abcam Scientific Support

    Answered on Apr 20 2012

    Question

    Yes, let’s go ahead with this.

    Read More

    Abcam community

    Verified customer

    Asked on Apr 03 2012

    Answer


    I am very pleased to hear you would like to accept our offer and test ab55566 inFunctional Studies.This code will give you 1 free protein before the expiration date. To redeem this offer, please submit an Abreview for Functional Studiesand include this code in the “Additional Comments” section so we know the Abreview is for this promotion. For more information on how to submit an Abreview, please visit the site: www.abcam.com/Abreviews.

    Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code.

    Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research.

    The terms and conditions applicable to this offer can be found here: www.abcam.com/collaborationdiscount.

    Read More

    Abcam Scientific Support

    Answered on Apr 03 2012

    Question

    Does this protein have any functional activity?

    Read More

    Abcam community

    Verified customer

    Asked on Mar 30 2012

    Answer

    Thank you very much for your interest in ab55566.

    To our knowledge, ab55566 has not been tested in functional assays. Therefore, I can offer a discount off a future purchase if you buy ab55566 now, test it in a functional assayand submit feedback to us in the form of an Abreview. It doesn't matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of 1 free protein.

    If you are interested in this offer, please follow these steps:

    1. Reply to this e-mail to let me know that you would like to proceed and test ab55566 in a functional assay. I will then send a discount code. This code must be issued before purchasing ab55566 so please wait for my reply before ordering.

    2. Purchase ab55566 either by phone, fax, or online (www.abcam.com).

    3. Test it in a functional assay.

    4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out how to submit an Abreview, please visit: https://www.abcam.com/abreviews.

    5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for anyprotein ordered and the discount code is valid for 4 months after issue.

    We are always pleased to obtain feedback about our products and any information is greatly appreciated! Even if ab55566 turns out to be unsuitable for functional studies, you will still receive the discount on your next purchase after your Abreview has been submitted.

    Please let me know if you have any questions about this offer and I would be happy to help you further.

    The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount.

    Read More

    Abcam Scientific Support

    Answered on Mar 30 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2022 Abcam plc. All rights reserved.