Description

  • Product name

    Recombinant human VEGFA protein (Active)
    See all VEGFA proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized VEGFR2/R3-Fc at 1 μg/ml can bind ab220553 with a linear range of 0.2-6.2 ng/ml.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      27 to 147
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 27 to 147. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab220553 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Folliculostellate cell-derived growth factor
    • Glioma-derived endothelial cell mitogen
    • MGC70609
    • MVCD1
    • vascular endothelial growth factor
    • Vascular endothelial growth factor A
    • vascular endothelial growth factor A121
    • vascular endothelial growth factor A165
    • Vascular permeability factor
    • Vegf
    • VEGF A
    • VEGF-A
    • VEGF120
    • Vegfa
    • VEGFA_HUMAN
    • VPF
    see all
  • Function

    Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth.
  • Tissue specificity

    Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed.
  • Involvement in disease

    Defects in VEGFA are a cause of susceptibility to microvascular complications of diabetes type 1 (MVCD1) [MIM:603933]. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis.
  • Sequence similarities

    Belongs to the PDGF/VEGF growth factor family.
  • Cellular localization

    Secreted. VEGF121 is acidic and freely secreted. VEGF165 is more basic, has heparin-binding properties and, although a signicant proportion remains cell-associated, most is freely secreted. VEGF189 is very basic, it is cell-associated after secretion and is bound avidly by heparin and the extracellular matrix, although it may be released as a soluble form by heparin, heparinase or plasmin.
  • Information by UniProt

Images

  • Immobilized Human VEGFR1/R2 (Fc Tag) at 1 µg/mL (100 µL/well) can bind Human VEGF121 (His Tag) with a linear range of 2-40 ng/mL (QC tested).
  • Immobilized VEGFR2/R3-Fc at 1 μg/ml can bind ab220553 with a linear range of 0.2-6.2 ng/ml.

  • SDS-PAGE analysis of reduced (lane 1) and non-reduced (lane 2) ab220553 stained overnight with Coomassie Blue. 

    The protein migrates as 17 kDa and 20 kDa under reducing conditions and 35-45 kDa under non-reducing conditions on SDS-PAGE gel.

References

ab220553 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220553.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up