Bioactive grade

Recombinant human VEGFB 167 protein (Active) (ab245959)

Description

  • Product name

    Recombinant human VEGFB 167 protein (Active)
  • Biological activity

    Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) in the presence of human VEGF165. The expected ED50 for this effect is 1.0-2.0 μg/ml.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPS CVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQ CECRPKKKDSAVKPDSPRPLCPRCTQHHQRPDPRTCRCRCRRRSFLRCQG RGLELNPDTCRCRKLRR
    • Amino acids

      21 to 188
    • Additional sequence information

      Full length mature chain without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab245959 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituent: 0.3% Acetic acid

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute in water to 0.1 - 1.0 mg/ml.

General Info

  • Alternative names

    • Vascular endothelial growth factor B
    • VEGF B
    • VEGF related factor
    • VEGFL
    • Vrf
    see all
  • Relevance

    Vascular endothelial growth factors (VEGFs) are a family of closely related growth factors having a conserved pattern of eight cysteine residues and sharing common VEGF receptors. VEGFs stimulate endothelial cells, induce angiogenesis, promote cell migration, increase vascular permeability, and inhibit apoptosis. VEGFB has structural similarities to VEGF and PIGF and is frequently co-expressed with VEGF. There are two alternatively spliced isoforms of VEGFB: VEGFB 167 and VEGFB 186. VEGFB 167, a highly basic heparin-binding protein, remains with the cell or extracellular matrix whereas, VEGFB 186 is readily secreted. VEGFB stimulates endothelial cell proliferation. VEGFB binds to the tyrosine kinase receptor VEGFR1 (flt1) and does not bind to VEGFR2. Vascular Endothelial Growth Factor B is widely expressed but is most abundant in heart, skeletal muscle, and pancreas. It has been suggested that VEGFB expression in human primary breast cancers is associated with lymph node metastasis.
  • Cellular localization

    Secreted protein. Secreted but remains associated to cells or to the extracellular matrix unless released by heparin.

References

ab245959 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab245959.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up