Recombinant human VEGFB 167 protein (Active) (ab245959)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies, HPLC
Description
-
Product name
Recombinant human VEGFB 167 protein (Active) -
Biological activity
Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) in the presence of human VEGF165. The expected ED50 for this effect is 1.0-2.0 μg/ml.
-
Purity
> 98 % SDS-PAGE.
Greater than 98% by HPLC analyses. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
PVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPS CVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQ CECRPKKKDSAVKPDSPRPLCPRCTQHHQRPDPRTCRCRCRRRSFLRCQG RGLELNPDTCRCRKLRR -
Predicted molecular weight
38 kDa -
Amino acids
21 to 188 -
Additional sequence information
Full length mature chain without signal peptide.
-
Specifications
Our Abpromise guarantee covers the use of ab245959 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
Constituent: 0.3% Acetic acid
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute in water to 0.1 - 1.0 mg/ml.
General Info
-
Alternative names
- Vascular endothelial growth factor B
- VEGF B
- VEGF related factor
see all -
Relevance
Vascular endothelial growth factors (VEGFs) are a family of closely related growth factors having a conserved pattern of eight cysteine residues and sharing common VEGF receptors. VEGFs stimulate endothelial cells, induce angiogenesis, promote cell migration, increase vascular permeability, and inhibit apoptosis. VEGFB has structural similarities to VEGF and PIGF and is frequently co-expressed with VEGF. There are two alternatively spliced isoforms of VEGFB: VEGFB 167 and VEGFB 186. VEGFB 167, a highly basic heparin-binding protein, remains with the cell or extracellular matrix whereas, VEGFB 186 is readily secreted. VEGFB stimulates endothelial cell proliferation. VEGFB binds to the tyrosine kinase receptor VEGFR1 (flt1) and does not bind to VEGFR2. Vascular Endothelial Growth Factor B is widely expressed but is most abundant in heart, skeletal muscle, and pancreas. It has been suggested that VEGFB expression in human primary breast cancers is associated with lymph node metastasis. -
Cellular localization
Secreted protein. Secreted but remains associated to cells or to the extracellular matrix unless released by heparin.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab245959 has not yet been referenced specifically in any publications.