Description

  • Product name

    Recombinant Human VEGFB protein
  • Purity

    > 90 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPS CVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQ CECRPKKKDSAVKPDRAATPHHRPQPRSVPGWDSAPGAPSPADITHPTPA PGPSAHAAPSTTSALTPGPAAAAADAAASSVAKGGA
    • Predicted molecular weight

      20 kDa including tags
    • Amino acids

      22 to 207
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Mature form.

Specifications

Our Abpromise guarantee covers the use of ab179970 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).

    pH: 7.4
    Constituents: 95% PBS, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in 20 µL sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing.

General Info

  • Alternative names

    • Vascular endothelial growth factor B
    • Vascular endothelial growth factor-related factor
    • VEGF B
    • VEGF related factor
    • VEGF-B
    • VEGF-related factor
    • Vegfb
    • VEGFB_HUMAN
    • VEGFL
    • VRF
    see all
  • Function

    Growth factor for endothelial cells. VEGF-B167 binds heparin and neuropilin-1 whereas the binding to neuropilin-1 of VEGF-B186 is regulated by proteolysis.
  • Tissue specificity

    Expressed in all tissues except liver. Highest levels found in heart, skeletal muscle and pancreas.
  • Sequence similarities

    Belongs to the PDGF/VEGF growth factor family.
  • Post-translational
    modifications

    VEGF-B186 is O-glycosylated.
  • Cellular localization

    Secreted. Secreted but remains associated to cells or to the extracellular matrix unless released by heparin.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab179970 stained overnight with Coomassie Blue. As a result of glycosylation, DTT-reduced protein migrates as 15-18 kDa and non-reduced protein migrates as 33-35 kDa.

References

ab179970 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179970.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up