Recombinant human VEGFC protein (ab155739)
- Datasheet
- References
- Protocols
Overview
-
Product nameRecombinant human VEGFC protein
See all VEGFC proteins and peptides -
Protein lengthFull length protein
Description
-
NatureRecombinant
-
SourceHEK 293 cells
-
Amino Acid Sequence
-
Accession
-
SpeciesHuman
-
SequenceTEETIKFAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFF KPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTIS FANHTSCRCMSKLDVYRQVHSIIRR
-
Molecular weight15 kDa including tags
-
Amino acids103 to 227
-
TagsHis tag C-Terminus
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab155739 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Biological activityMeasured in a cell proliferation assay using HMVEC human microvascular endothelial cells. The ED50 for this effect is typically 0.15-0.7 µg/ml.
-
Applications
Functional Studies
SDS-PAGE
-
Endotoxin level< 1.000 Eu/µg
-
Purity> 97 % SDS-PAGE.
-
FormLyophilised
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 95% PBS, 5% Trehalose
Note: Normally Mannitol or Trehalose are added as protectants before lyophilisation.This product is an active protein and may elicit a biological response in vivo, handle with caution.
General Info
-
Alternative names
- Flt 4L
- Flt4 ligand
- FLT4 ligand DHM
see all -
FunctionGrowth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors.
-
Tissue specificitySpleen, lymph node, thymus, appendix, bone marrow, heart, placenta, ovary, skeletal muscle, prostate, testis, colon and small intestine and fetal liver, lung and kidney, but not in peripheral blood lymphocyte.
-
Sequence similaritiesBelongs to the PDGF/VEGF growth factor family.
-
Post-translational
modificationsUndergoes a complex proteolytic maturation which generates a variety of processed secreted forms with increased activity toward VEGFR-3, but only the fully processed form could activate VEGFR-2. VEGF-C first form an antiparallel homodimer linked by disulfide bonds. Before secretion, a cleavage occurs between Arg-227 and Ser-228 producing an heterotetramer. The next extracellular step of the processing removes the N-terminal propeptide. Finally the mature VEGF-C is composed mostly of two VEGF homology domains (VHDs) bound by non-covalent interactions. -
Cellular localizationSecreted.
- Information by UniProt
Images
-
SDS-PAGE - Recombinant human VEGFC protein (ab155739)SDS-PAGE analysis of reduced ab155739 stained overnight with Coomassie Blue.
Datasheets and documents
References
ab155739 has not yet been referenced specifically in any publications.
