Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ADPAHYNTEI LKSIDNEWRK TQCMPREVCI DVGKEFGVAT NTFFKPPCVS VYRCGGCCNSEGLQCMNTSTSYLSKTLFEI TVPLSQGPKPVTISFANHTS CRCMSKLDVY RQVHSIIRRH HHHHH
    • Molecular weight
      14 kDa
    • Amino acids
      112 to 227
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Mature protein without signal and propetides.

Specifications

Our Abpromise guarantee covers the use of ab219245 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 20% Glycerol, 80% PBS

General Info

  • Alternative names
    • Flt 4L
    • Flt4 ligand
    • FLT4 ligand DHM
    • Flt4-L
    • Flt4L
    • Vascular endothelial growth factor C
    • Vascular endothelial growth factor related protein
    • Vascular endothelial growth factor-related protein
    • VEGF C
    • VEGF-C
    • Vegfc
    • VEGFC_HUMAN
    • VRP
    see all
  • Function
    Growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. May function in angiogenesis of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. Binds and activates VEGFR-2 (KDR/FLK1) and VEGFR-3 (FLT4) receptors.
  • Tissue specificity
    Spleen, lymph node, thymus, appendix, bone marrow, heart, placenta, ovary, skeletal muscle, prostate, testis, colon and small intestine and fetal liver, lung and kidney, but not in peripheral blood lymphocyte.
  • Sequence similarities
    Belongs to the PDGF/VEGF growth factor family.
  • Post-translational
    modifications
    Undergoes a complex proteolytic maturation which generates a variety of processed secreted forms with increased activity toward VEGFR-3, but only the fully processed form could activate VEGFR-2. VEGF-C first form an antiparallel homodimer linked by disulfide bonds. Before secretion, a cleavage occurs between Arg-227 and Ser-228 producing an heterotetramer. The next extracellular step of the processing removes the N-terminal propeptide. Finally the mature VEGF-C is composed mostly of two VEGF homology domains (VHDs) bound by non-covalent interactions.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE using 3ug of ab219245.

References

ab219245 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab219245.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up