Description

  • Product name

    Recombinant Human Versican protein (Tagged)
    See all Versican proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GPDRCKMNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPCRN GATCVDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRR TWDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFR WTDGSTLQYENWRPNQPDSFFSAGEDCVVIIWHENGQWNDVPCNYHLTYT CKKGTVACGQPPVVENAKTFGKMKPRYEINSLIRYHCKDGFIQRHLPTIR CLGNGRWAIPKITCMN
    • Predicted molecular weight

      48 kDa including tags
    • Amino acids

      3089 to 3354
    • Additional sequence information

      N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged.

Specifications

Our Abpromise guarantee covers the use of ab236178 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • Chondroitin sulfate proteoglycan 2
    • Chondroitin sulfate proteoglycan core protein 2
    • Chondroitin sulfate proteoglycan core protein, cartilage
    • CSPG2
    • CSPG2_HUMAN
    • ERVR
    • GHAP
    • Glial hyaluronate binding protein
    • Glial hyaluronate-binding protein
    • Large fibroblast proteoglycan
    • PG-M
    • PGM
    • VCAN
    • Versican
    • Versican core protein
    • Versican proteoglycan
    • WGN
    • WGN 1
    • WGN1
    see all
  • Function

    May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.
  • Tissue specificity

    Cerebral white matter and plasma. Isoform V0 and isoform V1 are expressed in normal brain, gliomas, medulloblastomas, schwannomas, neurofibromas, and meningiomas. Isoform V2 is restricted to normal brain and gliomas. Isoform V3 is found in all these tissues except medulloblastomas.
  • Involvement in disease

    Defects in VCAN are the cause of Wagner syndrome type 1 (WGN1) [MIM:143200]. WGN is a dominantly inherited vitreoretinopathy characterized by an optically empty vitreous cavity with fibrillary condensations and a preretinal avascular membrane. Other optical features include progressive chorioretinal atrophy, perivascular sheating, subcapsular cataract and myopia. Systemic manifestations are absent in WGN.
  • Sequence similarities

    Belongs to the aggrecan/versican proteoglycan family.
    Contains 1 C-type lectin domain.
    Contains 2 EGF-like domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
    Contains 2 Link domains.
    Contains 1 Sushi (CCP/SCR) domain.
  • Developmental stage

    Disappears after the cartilage development.
  • Post-translational
    modifications

    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab236178.

References

ab236178 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236178.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up