Overview

  • Product name

    Recombinant Human Vgl4 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      METPLDVLSRAASLVHADDEKREAALRGEPRMQTLPVASALSSHRTGPPP ISPSKRKFSMEPGDEDLDCDNDHVSKMSRIFNPHLNKTANGDCRRDPRER SRSPIERAVAPTMSLHGSHLYTSLPSLGLEQPLALTKNSLDASRPAGLSP TLTPGERQQNRPSVITCASAGARNCNLSHCPIAHSGCAAPGPASYRRPPS AATTCDPVVEEHFRRSLGKNYKEPEPAPNSVSITGSVDDHFAKALGDTWL QIKAAKDGASSSPESASRRGQPASPSAHMVSHSHSPSVVS
    • Amino acids

      1 to 290
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160607 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Transcription cofactor vestigial like protein 4
    • Vestigial like protein 4
    • VGL 4
    • VGLL4
  • Relevance

    Vgl4, vestigial-like protein 4 is a member of the vestigial family of proteins. It interacts with mammalian Transcriptional Enhancer Factors (TEFs) and may be a specific coactivator. Vgl4 also counteracts alpha1-adrenergic activation of gene expression in cardiac myocytes. There are 2 isoforms produced by alternative splicing.
  • Cellular localization

    Nuclear

Images

  • ab160607 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160607 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160607.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up