Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MWVLTPAAFAGKLLSVFRQPLSSLWRSLVPLFCWLRATFWLLATKRRKQQ LVLRGPDETKEEEEDPPLPTTPTSVNYHFTRQCNYKCGFCFHTAKTSFVL PLEEAKRGLLLLKEAGMEKINFSGGEPFLQDRGEYLGKLVRFCKVELRLP SVSIVSNGSLIRERWFQNYGEYLDILAISCDSFDEEVNVLIGRGQGKKNH VENLQKLRRWCRDYRVAFKINSVINRFNVEEDMTEQIKALNPVRWKVFQC LLIEGENCGEDALREAERFVIGDEEFERFLERHKEVSCLVPESNQKMKDS YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKY IWSKADLKLDW
    • Amino acids
      1 to 361
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164861 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2510004L01Rik
    • cig 33
    • CIG 5
    • cig-33
    • CIG-5
    • CIG33
    • CIG5
    • Cytomegalovirus induced gene 5 protein
    • Cytomegalovirus-induced gene 5 protein
    • endoplasmic reticulum-associated
    • interferon-inducible
    • Radical S adenosyl methionine domain containing 2
    • Radical S-adenosyl methionine domain-containing protein 2
    • RSAD 2
    • Rsad2
    • RSAD2_HUMAN
    • RSDA-2
    • VIG 1
    • vig1
    • Viperin
    • Virus inhibitory protein
    • virus inhibitory protein endoplasmic reticulum associated interferon inducible
    see all
  • Function
    Involved in antiviral defense. May impair virus budding by disrupting lipid rafts at the plasma membrane, a feature which is essential for the budding process of many viruses. Acts through binding with and inactivating FPPS, an enzyme involved in synthesis of cholesterol, farnesylated and geranylated proteins, ubiquinones dolichol and heme. Plays a major role in the cell antiviral state induced by type I and type II interferon. Displays antiviral effect against HIV-1 virus, hepatitis C virus, human cytomegalovirus, and aphaviruses, but not vesiculovirus.
  • Sequence similarities
    Belongs to the RSAD2 family.
  • Cellular localization
    Endoplasmic reticulum membrane. Golgi apparatus. Probably associates with the cytosolic side of the endoplasmic reticulum. Infection with human cytomegalovirus (HCMV) causes relocation to the Golgi apparatus and to cytoplasmic vacuoles which also contain HCMV proteins glycoprotein B and pp28.
  • Information by UniProt

Images

  • ab164861 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164861 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164861.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up