Recombinant Human VISTA protein (Fc, Avi tag) (Biotin) (ab246103)

Description

  • Product name

    Recombinant Human VISTA protein (Fc, Avi tag) (Biotin)
    See all VISTA proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    The biotin to protein ratio is 0.6-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      FKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQT CSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSIT MRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYP SSSQDSENITAA
    • Predicted molecular weight

      47 kDa including tags
    • Amino acids

      33 to 194
    • Tags

      Avi tag C-Terminus , Fc tag C-Terminus
    • Additional sequence information

      Extracellular domain. AAH20568.1 AviTag sequence: GLNDIFEAQKIEWHE
  • Conjugation

    Biotin
  • Description

    Recombinant Human VISTA protein (Tagged) (Biotin)

Associated products

Specifications

Our Abpromise guarantee covers the use of ab246103 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.50
    Constituents: 5% Trehalose, 0.61% Tris, 0.75% Glycine

    0.22 µm filtered

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long-term storage.

General Info

  • Alternative names

    • B7 H5
    • B7H5
    • C10orf54
    • chromosome 10 open reading frame 54
    • DD1alpha
    • GI24
    • GI24_HUMAN
    • PD-1H
    • PDCD1 homolog
    • Platelet receptor Gi24
    • PP2135
    • sisp 1
    • SISP1
    • stress induced secreted protein 1
    • UNQ730/PRO1412
    • V domain Ig suppressor of T cell activation
    • V set domain containing immunoregulatory receptor
    • V set immunoregulatory receptor
    • V type immunoglobulin domain containing suppressor of T cell activation
    • VISTA
    see all
  • Sequence similarities

    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • Reducing SDS-PAGE analysis of ab246103.

    The protein has a calculated MW of 47.1 kDa. The protein migrates as 55-66 kDa under reducing conditions due to glycosylation.

References

ab246103 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246103.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up