Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      FKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQT CSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSIT MRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYP SSSQDSENITAAIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK DTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQV YTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Molecular weight

      47 kDa including tags
    • Amino acids

      33 to 194
    • Additional sequence information

      Human secreted fragment of VISTA (amino acids 33-194, fused with a 6 amino acid linker (IEGRMDP) to Fc of Human IgG1 (a.a. 100-330).

Specifications

Our Abpromise guarantee covers the use of ab198480 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    >= 90 % SDS-PAGE.

  • Form

    Liquid
  • Additional notes

    ab198480 is useful for studying protein binding and screening small molecules.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol

General Info

  • Alternative names

    • B7 H5
    • B7H5
    • C10orf54
    • chromosome 10 open reading frame 54
    • DD1alpha
    • GI24
    • GI24_HUMAN
    • PD-1H
    • PDCD1 homolog
    • Platelet receptor Gi24
    • PP2135
    • sisp 1
    • SISP1
    • stress induced secreted protein 1
    • UNQ730/PRO1412
    • V domain Ig suppressor of T cell activation
    • V set domain containing immunoregulatory receptor
    • V set immunoregulatory receptor
    • V type immunoglobulin domain containing suppressor of T cell activation
    • VISTA
    see all
  • Sequence similarities

    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 4-20% SDS PAGE analysis of ab198477 (3.5 μg). This protein runs at a higher MW by SDS-PAGE due to glycosylation.

References

ab198480 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198480.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up