Bioactive grade

Recombinant human VISTA protein (Fc Chimera Active) (ab220564)

Description

  • Product name

    Recombinant human VISTA protein (Fc Chimera Active)
    See all VISTA proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA. Immobilized Human VSIG8, His Tag at 10 μg/mL (100 μL/well) can bind ab220564 with a linear range of 0.625-20 μg/mL. 

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      FKVATPYSLYVCPEGQNVTLTCRLLGPVDKGHDVTFYKTWYRSSRGEVQT CSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLESASDHHGNFSIT MRNLTLLDSGLYCCLVVEIRHHHSEHRVHGAMELQVQTGKDAPSNCVVYP SSSQDSENITAA
    • Predicted molecular weight

      45 kDa including tags
    • Amino acids

      33 to 194
    • Additional sequence information

      Extracellular domain (AAH20568). This protein carries a human IgG1 Fc tag ((Pro 100 - Lys 330) P01857) at the C-terminus.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab220564 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1 mg/mL. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • B7 H5
    • B7H5
    • C10orf54
    • chromosome 10 open reading frame 54
    • DD1alpha
    • GI24
    • GI24_HUMAN
    • PD-1H
    • PDCD1 homolog
    • Platelet receptor Gi24
    • PP2135
    • sisp 1
    • SISP1
    • stress induced secreted protein 1
    • UNQ730/PRO1412
    • V domain Ig suppressor of T cell activation
    • V set domain containing immunoregulatory receptor
    • V set immunoregulatory receptor
    • V type immunoglobulin domain containing suppressor of T cell activation
    • VISTA
    see all
  • Sequence similarities

    Contains 1 Ig-like (immunoglobulin-like) domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • Immobilized Human VSIG8, His Tag at 10 μg/mL (100 μL/well) can bind ab220564 with a linear range of 0.625-20 μg/mL. 

  • SDS-PAGE analysis of reduced ab220564 stained overnight with Coomassie Blue.

    The protein migrates as 55-60 kDa under reducing conditions due to glycosylation.

References

ab220564 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220564.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up