Description

  • Product name

    Recombinant Human Vitamin D Binding protein (His tag)
    See all Vitamin D Binding protein proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      RGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVV SLTEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLE RKLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYG QAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNR VCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCES ASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAA QLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPT LKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEY KKKLAERLKAKLPDATPTELAKLVNKHSDFASNCCSINSPPLYCDSEIDA ELKNIL
    • Predicted molecular weight

      55 kDa including tags
    • Amino acids

      19 to 474
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab225668 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names

    • DBP
    • DBP/GC
    • GC
    • Gc globulin
    • Gc-globulin
    • GRD3
    • Group specific component
    • Group specific component vitamin D binding protein
    • Group-specific component
    • hDBP
    • VDB
    • VDBG
    • VDBP
    • Vitamin D binding alpha globulin
    • Vitamin D-binding protein
    • VTDB_HUMAN
    see all
  • Function

    Multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid, and urine and on the surface of many cell types. In plasma, it carries the vitamin D sterols and prevents polymerization of actin by binding its monomers. DBP associates with membrane-bound immunoglobulin on the surface of B-lymphocytes and with IgG Fc receptor on the membranes of T-lymphocytes.
  • Sequence similarities

    Belongs to the ALB/AFP/VDB family.
    Contains 3 albumin domains.
  • Cellular localization

    Secreted.
  • Information by UniProt

References

ab225668 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225668.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up