Description

  • Product name

    Recombinant human VLDL Receptor/VLDL-R protein
  • Biological activity

    Measured by its binding ability in a functional ELISA. When Recombinant Human Apolipoprotein E3 is immobilized at 1 µg/ml (100 µl/well), the concentration of Recombinant Human VLDLR that produces 50% of the optimal binding response is found to be approximately 0.03 - 0.15 µg/ml.
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GRKAKCEPSQFQCTNGRCITLLWKCDGDEDCVDGSDEKNCVKKTCAESDF VCNNGQCVPSRWKCDGDPDCEDGSDESPEQCHMRTCRIHEISCGAHSTQC IPVSWRCDGENDCDSGEDEENCGNITCSPDEFTCSSGRCISRNFVCNGQD DCSDGSDELDCAPPTCGAHEFQCSTSSCIPISWVCDDDADCSDQSDESLE QCGRQPVIHTKCPASEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRT CRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNCKNVNQCLGPGKFKCR SGECIDISKVCNQEQDCRDWSDEPLKECHINECLVNNGGCSHICKDLVIG YECDCAAGFELIDRKTCGDIDECQNPGICSQICINLKGGYKCECSRGYQM DLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNTVALDAD IAAQKLFWADLSQKAIFSASIDDKVGRHVKMIDNVYNPAAIAVDWVYKTI YWTDAASKTISVATLDGTKRKFLFNSDLREPASIAVDPLSGFVYWSDWGE PAKIEKAGMNGFDRRPLVTADIQWPNGITLDLIKSRLYWLDSKLHMLSSV DLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGENEAVYGANKFTGSE LATLVNNLNDAQDIIVYHELVQPSGKNWCEEDMENGGCEYLCLPAPQIND HSPKYTCSCPSGYNVEENGRDCQSTATTVTYSETKDTNTTEISATSGLVP GGINVTTAVSEVSVPPKGTS
    • Predicted molecular weight

      86 kDa including tags
    • Amino acids

      28 to 797
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab155621 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    ELISA

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Previously labelled as VLDL Receptor. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute ab155621 in sterile PBS to a final concentration of 50 µg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage. Avoid vigorous shaking or vortexing.

General Info

  • Alternative names

    • FLJ35024
    • Very low density lipoprotein receptor
    • Very low-density lipoprotein receptor
    • VLDL R
    • VLDL receptor
    • VLDL-R
    • VLDLR
    • VLDLR_HUMAN
    • VLDLRCH
    see all
  • Function

    Binds VLDL and transports it into cells by endocytosis. In order to be internalized, the receptor-ligand complexes must first cluster into clathrin-coated pits. Binding to Reelin induces tyrosine phosphorylation of Dab1 and modulation of Tau phosphorylation.
  • Tissue specificity

    Abundant in heart and skeletal muscle; also ovary and kidney; not in liver.
  • Involvement in disease

    Defects in VLDLR are the cause of cerebellar ataxia mental retardation and dysequilibrium syndrome type 1 (CMARQ1) [MIM:224050]; also known as dysequilibrium syndrome (DES) or non-progressive cerebellar disorder with mental retardation. CMARQ1 is a congenital, non-progressive cerebellar ataxia associated with disturbed equilibrium, delayed ambulation, mental retardation and cerebellar hypoplasia. Additional features include short stature, strabismus, pes planus and, rarely, seizures.
  • Sequence similarities

    Contains 3 EGF-like domains.
    Contains 8 LDL-receptor class A domains.
    Contains 6 LDL-receptor class B repeats.
  • Post-translational
    modifications

    Ubiquitinated at Lys-839 by MYLIP leading to degradation.
  • Cellular localization

    Membrane. Membrane > clathrin-coated pit.
  • Information by UniProt

Images

  • Human VLDL R, His Tag on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 90%.
  • Immobilized Human VLDL R, His Tag at 5 µg/mL (100 µL/well) can bind Biotinylated Human PCSK9, His Tag with a linear range of 10-156 ng/mL.
  • Purity of ab155621 determined by SDS-PAGE under reduced conditions and stained overnight with Coomassie Blue.

References

ab155621 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab155621.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up