Description

  • Product name

    Recombinant Human VNN1/Vanin-1 protein
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QDTFTAAVYEHAAILPNATLTPVSREEALALMNRNLDILEGAITSAADQG AHIIVTPEDAIYGWNFNRDSLYPYLEDIPNPEVNWIPCNNRNRFGQTPVQ ERLSCLAKNNSIYVVANIGDKKPCDTSDPQCPPDGRYQYNTDVVFDSQGK LVARYHKQNLFMGENQFNVPKEPEIVTFNTTFGSFGIFTCFDILFHDPAV TLVKDFHVDTIVFPTAWMNVLPHLSAVEFHSAWAMGMRVNFLASNIHYPS KKMTGSGIYAPNSSRAFHYDMKTEEGKLLLSQLDSHPSHSAVVNWTSYAS SIEALSSGNKEFKGTVFFDEFTFVKLTGVAGNYTVCQKDLCCHLSYKMSE NIPNEVYALGAFDGLHTVEGRYYLQICTLLKCKTTNLNTCGDSAETASTR FEMFSLSGTFGTQYVFPEVLLSENQLAPGEFQVSTDGRLFSLKPTSGPVL TVTLFGRLYEKDWASNASSVDHHHHHH
    • Predicted molecular weight

      53 kDa including tags
    • Amino acids

      22 to 490
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152005 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as VNN1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • HDLCQ8
    • High density lipoprotein cholesterol level quantitative trait locus 8, included
    • Pantetheinase
    • Pantetheine hydrolase
    • Tiff66
    • V-1
    • Vanin 1
    • Vanin-1
    • Vannin 1
    • Vascular non inflammatory molecule 1
    • Vascular non-inflammatory molecule 1
    • VNN 1
    • VNN1
    • VNN1_HUMAN
    see all
  • Function

    Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine.
  • Tissue specificity

    Widely expressed with higher expression in spleen, kidney and blood. Overexpressed in lesional psoriatic skin.
  • Sequence similarities

    Belongs to the CN hydrolase family. BTD/VNN subfamily.
    Contains 1 CN hydrolase domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

References

ab152005 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152005.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up