Recombinant Human Von Willebrand Factor protein (Tagged) (ab152801)
Key features and details
- Expression system: Wheat germ
- Purity: >= 80% Purified via GST Tag
- Tags: GST tag N-Terminus
- Suitable for: SDS-PAGE, WB, ELISA
Description
-
Product name
Recombinant Human Von Willebrand Factor protein (Tagged)
See all Von Willebrand Factor proteins and peptides -
Purity
>= 80 % Purified via GST Tag.
Glutathione Sepharose -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGAQDEEEGIQDLDGLLVFDKIVEVTLLNLPWYNEETEGQRGEMTAPKSP RAKIRGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYLLAG GCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPY ASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCG NFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCERASPPSSSCNIS SGEMQKVGVDWPGCTWMVCDFWI -
Predicted molecular weight
56 kDa including tags -
Amino acids
1 to 273 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab152801 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Western blot
ELISA
-
Form
Liquid -
Additional notes
This recombinant protein is a short type (isoform) of VWF.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- Coagulation factor VIII
- Coagulation factor VIII VWF
- F8VWF
see all -
Function
Important in the maintenance of hemostasis, it promotes adhesion of platelets to the sites of vascular injury by forming a molecular bridge between sub-endothelial collagen matrix and platelet-surface receptor complex GPIb-IX-V. Also acts as a chaperone for coagulation factor VIII, delivering it to the site of injury, stabilizing its heterodimeric structure and protecting it from premature clearance from plasma. -
Tissue specificity
Plasma. -
Involvement in disease
Defects in VWF are the cause of von Willebrand disease (VWD) [MIM:277480]. VWD defines a group of hemorrhagic disorders in which the von Willebrand factor is either quantitatively or qualitatively abnormal resulting in altered platelet function. Symptoms vary depending on severity and disease type but may include prolonged bleeding time, deficiency of factor VIII and impaired platelet adhesion. Type I von Willebrand disease is the most common form and is characterized by partial quantitative plasmatic deficiency of an otherwise structurally and functionally normal Willebrand factor; type II is associated with a qualitative deficiency and functional anomalies of the Willebrand factor; type III is the most severe form and is characterized by total or near-total absence of Willebrand factor in the plasma and cellular compartments, also leading to a profound deficiency of plasmatic factor VIII. -
Sequence similarities
Contains 1 CTCK (C-terminal cystine knot-like) domain.
Contains 4 TIL (trypsin inhibitory-like) domains.
Contains 3 VWFA domains.
Contains 3 VWFC domains.
Contains 4 VWFD domains. -
Domain
The von Willebrand antigen 2 is required for multimerization of vWF and for its targeting to storage granules. -
Post-translational
modificationsAll cysteine residues are involved in intrachain or interchain disulfide bonds.
N- and O-glycosylated. -
Cellular localization
Secreted. Secreted > extracellular space > extracellular matrix. Localized to storage granules. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab152801 has been referenced in 1 publication.
- Chen X et al. Hypoxia inducible factor and microvessels in peri-implantation endometrium of women with recurrent miscarriage. Fertil Steril 105:1496-1502.e4 (2016). PubMed: 27018158