Description

  • Product name

    Recombinant Human VPAC1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRPPSPLPARWLCVLAGALAWALGPAGGQAARLQEECDYVQMIEVQHKQC LEEAQLENETIGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRN VSRSCTDEGWTHLEPGPYPIACGLDDKAASLDEQQTMFYGSVKTGYTIGY GLSLATLLVATAILSLFRKLHCTRNYIHMHLFISFILRAAAVFIKDLALF DSGESDQCSEGSVGCKAAMVFFQYCVMANFFWLLVEGLYLYTLLAVSFFS ERKYFWGYILIGWGVPSTFTMVWTIARIHFEDYGCWDTINSSLWWIIKGP ILTSILVNFILFICIIRILLQKLRPPDIRKSDSSPYSRLAMSTLLLIPLF GVHYIMFAFFPDNFKPEVKMVFELVVGSFQGFVVAILYCFLNGEVQAELR RKWRRWHLQGVLGWNPKYRHPSGGSNGATCSTQVSMLTRVSPGARRSSSF QAEVSLV
    • Amino acids

      1 to 457
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159803 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as VIP Receptor 1, VIPR1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ41949
    • HVR 1
    • HVR1
    • PACAP R 2
    • PACAP type II receptor
    • PACAP-R-2
    • PACAP-R2
    • Pituitary adenylate cyclase activating polypeptide receptor type II
    • Pituitary adenylate cyclase activating polypeptide type II receptor
    • Pituitary adenylate cyclase-activating polypeptide type II receptor
    • RCD1
    • RDC 1
    • RDC1
    • V1RG
    • VAPC 1
    • VAPC1
    • Vasoactive intestinal peptide receptor 1
    • Vasoactive intestinal polypeptide receptor 1
    • Vasoactive intestinal polypeptide receptor 1 precursor
    • VIP and PACAP receptor 1
    • VIP R 1
    • VIP receptor type I
    • VIP-R-1
    • VIPR
    • VIPR 1
    • VIPR1
    • VIPR1_HUMAN
    • VIRG
    • VPAC 1
    • VPAC1
    • VPCAP1R
    see all
  • Function

    This is a receptor for VIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The affinity is VIP = PACAP-27 > PACAP-38.
  • Tissue specificity

    In lung, HT29 colonic epithelial cells, Raji B-lymphoblasts. Lesser extent in brain, heart, kidney, liver and placenta. Not expressed in CD4+ or CD8+ T-cells. Expressed in the T-cell lines HARRIS, HuT 78, Jurkat and Tsup-1, but not in the T-cell lines PEER, MOLT-4, HSB and YT.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 2 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab159803 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159803 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159803.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up