Description

  • Product name

    Recombinant Human VPAC2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRTLLPPALLTCWLLAPVNSIHPECRFHLEIQEEETKCAELLRSQTEKHK ACSGVWDNITCWRPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDGWSE TFPDFVDACGYSDPEDESKITFYILVKAIYTLGYSVSLMSLATGSIILCL FRKLHCTRNYIHLNLFLSFILRAISVLVKDDVLYSSSGTLHCPDQPSSWV GCKLSLVFLQYCIMANFFWLLVEGLYLHTLLVAMLPPRRCFLAYLLIGWG LPTVCIGAWTAARLYLEDTGCWDTNDHSVPWWVIRIPILISIIVNFVLFI SIIRILLQKLTSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAVFPIS ISSKYQILFELCLGSFQGLVVAVLYCFLNSEVQCELKRKWRSRCPTPSAS RDYRVCGSSFSRNGSEGALQFHRGSRAQSFLQTETSVI
    • Amino acids

      1 to 438
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159805 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Helodermin-preferring VIP receptor
    • PACAP type III receptor
    • PACAP-R-3
    • PACAP-R3
    • Pituitary adenylate cyclase-activating polypeptide type III receptor
    • Vasoactive intestinal polypeptide receptor 2
    • VIP Receptor 2
    • VIP-R-2
    • Vipr2
    • VIPR2_HUMAN
    • VPAC2 receptor
    see all
  • Function

    This is a receptor for VIP as well as PACAP-38 and -27, the activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Can be coupled to phospholipase C.
  • Tissue specificity

    Expressed in CD4+ T-cells, but not in CD8+ T-cells. Expressed in the T-cell lines Jurkat, PEER, MOLT-4, HSB, YT and Tsup-1, but not in the T-cell lines HARRIS and HUT 78.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 2 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab159805 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159805 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159805.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up