Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWRPANVGETVTV PCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKITFY ILV
    • Amino acids
      24 to 126
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159806 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Helodermin-preferring VIP receptor
    • PACAP type III receptor
    • PACAP-R-3
    • PACAP-R3
    • Pituitary adenylate cyclase-activating polypeptide type III receptor
    • Vasoactive intestinal polypeptide receptor 2
    • VIP Receptor 2
    • VIP-R-2
    • Vipr2
    • VIPR2_HUMAN
    • VPAC2 receptor
    see all
  • Function
    This is a receptor for VIP as well as PACAP-38 and -27, the activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Can be coupled to phospholipase C.
  • Tissue specificity
    Expressed in CD4+ T-cells, but not in CD8+ T-cells. Expressed in the T-cell lines Jurkat, PEER, MOLT-4, HSB, YT and Tsup-1, but not in the T-cell lines HARRIS and HUT 78.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 2 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab159806 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159806 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159806.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up