Overview

  • Product name

    Recombinant Human VPS16 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDCYTANWNPLGDSAFYRKYELYSMDWDLKEELRDCLVAAAPYGGPIALL RNPWRKEKAASVRPVLDIYSASGMPLASLLWKSGPVVSLGWSAEEELLCV QEDGAVLVYGLHGDFRRHFSMGNEVLQNRVLDARIFHTEFGSGVAILTGA HRFTLSANVGDLKLRRMPEVPGLQSAPSCWTVLCQDRVAHILLAVGPDLY LLDHAACSAVTPPGLAPGVSSFLQMAVSFTYRHLALFTDTGYIWMGTASL KEKLCEFNCNIRAPPKQMVWCSRPRSKERAVVVAWERRLMVVGDAPESIQ FVLDEDSYLVPELDGVRIFSRSTHEFLHEVPAASEEIFKIASMAPGALLL EAQKEYEKESQKADEYLREIQELGQLTQAVQQCIEAAGHEHQPDMQKSLL RAASFGKCFLDRFPPDSFVHMCQDLRVLNAVRDYHIGIPLTYSQYKQLTI QVLLDRLVLRRLYPLAIQICEYLRLPEVQGVSRILAHWACYKVQQKDVSD EDVARAINQKLGDTPGVSYSDIAARAYGCGRTELAIKLLEYEPRSGEQVP LLLKMKRSKLALSKAIESGDTDLVFTVLLHLKNELNRGDFFMTLRNQPMA LSLYRQFCKHQELETLKDLYNQDDNHQELGSFHIRASYAAEERIEGRVAA LQTAADAFYKAKNEFAAKATEDQMRLLRLQRRLEDELGGQFLDLSLHDTV TTLILGGHNKRAEQLARDFRIPDKRLWWLKLTALADLEDWEELEKFSKSK KSPIGYLPFVEICMKQHNKYEAKKYASRVGPEQKVKALLLVGDVAQAADV AIEHRNEAELSLVLSHCTGATDGATADKIQRARAQAQKK
    • Molecular weight

      121 kDa including tags
    • Amino acids

      1 to 839

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132249 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HGNC:14584
    • hVPS16
    • mVPS16
    • RP11 12M19.2
    • Vacuolar protein sorting 16
    • Vacuolar protein sorting 16 (yeast)
    • Vacuolar protein sorting 16 (Yeast), isoform CRA_a
    • Vacuolar protein sorting 16 homolog (S. cerevisiae)
    • vacuolar protein sorting associated protein 16 homolog
    • Vacuolar protein sorting protein 16
    • Vacuolar protein sorting-associated protein 16 homolog
    • VPS16
    • VPS16_HUMAN
    • VPS16A
    see all
  • Function

    May play a role in vesicle-mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes.
  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Belongs to the VPS16 family.
  • Cellular localization

    Late endosome membrane. Lysosome membrane. Cytoplasmic, peripheral membrane protein associated with late endosomes/lysosomes.
  • Information by UniProt

Images

  • ab132249 analyzed by 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab132249 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132249.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up