Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMSFLGGFFGPICEIDIVLNDGETRKMA EMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPGKRLEHQGIRIEFVGQIE LFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYESYIGANVR LRYFLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIE FEYNKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTTET ETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLV LVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPESQASAEQPEM
    • Molecular weight

      41 kDa including tags
    • Amino acids

      1 to 327
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab130047 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 85 % SDS-PAGE.
    ab130047 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • FLJ12930
    • HB 58
    • HB58
    • Hbeta 58
    • Hbeta 58 homolog
    • Hbeta58
    • Hbeta58 homolog
    • hVPS 26
    • hVPS26
    • MGC94168
    • PEP 8A
    • PEP8A
    • Vacuolar protein sorting 26
    • Vacuolar protein sorting 26 A
    • Vacuolar protein sorting 26 homolog A
    • Vacuolar protein sorting 26 homolog A S. pombe
    • Vacuolar protein sorting 26 homolog A yeast
    • Vacuolar protein sorting 26 yeast
    • Vacuolar protein sorting 26 yeast homolog
    • Vacuolar protein sorting 26A
    • Vacuolar protein sorting associated protein 26A
    • Vacuolar protein sorting-associated protein 26A
    • Vesicle protein sorting 26
    • Vesicle protein sorting 26A
    • VP26A_HUMAN
    • VPS 26
    • VPS 26A
    • VPS26A
    see all
  • Function

    Essential component of the retromer complex, a complex required to retrieve lysosomal enzyme receptors (IGF2R and M6PR) from endosomes to the trans-Golgi network. Also required to regulate transcytosis of the polymeric immunoglobulin receptor (pIgR-pIgA).
  • Sequence similarities

    Belongs to the VPS26 family.
  • Cellular localization

    Cytoplasm. Endosome membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg of Human VPS26 protein (ab130047)

References

ab130047 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab130047.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up