Description

  • Product name

    Recombinant human VPS34 protein
    See all VPS34 proteins and peptides
  • Biological activity

    Specific Activity: 140 pmol/min/μg.

     

  • Purity

    >= 70 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQ ETCSDLYVTCQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLP RNAQVALTIWDVYGPGKAVPVGGTTVSLFGKYGMFRQGMHDLKVWPNVEA DGSEPTKTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREI EMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFE LVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIVS YPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALEL LGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQ ALKYENFDDIKNGLEPTKKDSQSSVSENVSNSGINSAEIDSSQIITSPLP SVSSPPPASKTKEVPDGENLEQDLCTFLISRACKNSTLANYLYWYVIVEC EDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDR LVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVKI RGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQII SLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQ NFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLL TKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQ CYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLS DEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK
    • Predicted molecular weight

      98 kDa including tags
    • Amino acids

      2 to 887
    • Tags

      DDDDK tag N-Terminus
    • Additional sequence information

      NM_002647.

Specifications

Our Abpromise guarantee covers the use of ab198071 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.

     This product was previously labelled as PI 3 Kinase Class 3

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT, 20% Glycerol

    80 µg/mL DDDDK peptide

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • hVps34
    • MGC61518
    • Phosphatidylinositol 3 kinase catalytic subunit type 3
    • Phosphatidylinositol 3 kinase class 3
    • Phosphatidylinositol 3 kinase p100 subunit
    • Phosphatidylinositol 3-kinase catalytic subunit type 3
    • Phosphatidylinositol 3-kinase p100 subunit
    • Phosphoinositide 3 kinase class 3
    • Phosphoinositide-3-kinase class 3
    • PI3 kinase type 3
    • PI3-kinase type 3
    • PI3K type 3
    • Pik3c3
    • PK3C3_HUMAN
    • PtdIns 3 kinase type 3
    • PtdIns-3-kinase type 3
    • Vps 34
    • Vps34
    see all
  • Function

    Catalytic subunit of the PI3K complex that mediates formation of phosphatidylinositol 3-phosphate. Involved in the transport of lysosomal enzyme precursors to lysosomes. Required for the abcission step in cytokinesis.
  • Tissue specificity

    Ubiquitously expressed, with a highest expression in skeletal muscle.
  • Sequence similarities

    Belongs to the PI3/PI4-kinase family.
    Contains 1 PI3K/PI4K domain.
  • Cellular localization

    Midbody.
  • Information by UniProt

Images

  • 10% SDS-PAGE analysis of ab198071 (4 µg) with Coomassie staining.

  • Example of specific activity of ab198071.

References

ab198071 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198071.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up