Description

  • Product name

    Recombinant Human VPS36 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MDRFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWR DQKNHECCMAILLSQIVFIEEQAAGIGKSAKIVVHLHPAPPNKEPGPFQS SKNSYIKLSFKEHGQIEFYRRLSEEMTQRRWENMPVSQSLQTNRGPQPGR IRAVGIVGIERKLEEKRKETDKNISEAFEDLSKLMIKAKEMVELSKSIAN KIKDKQGDITEDETIRFKSYLLSMGIANPVTRETYGSGTQYHMQLAKQLA GILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACKMLEALKLP LRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSV LLAKERLLLAEKMGHLCRDDSVEGLRFYPNLFMTQS
    • Amino acids

      1 to 386
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162398 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C13orf9
    • CGI 145
    • EAP45
    • ELL associated protein of 45 kDa
    • ELL-associated protein of 45 kDa
    • ESCRT-II complex subunit VPS36
    • Vacuolar protein sorting associated protein 36
    • Vacuolar protein-sorting-associated protein 36
    • Vps36
    • VPS36_HUMAN
    see all
  • Function

    Component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. Its ability to bind ubiquitin probably plays a role in endosomal sorting of ubiquitinated cargo proteins by ESCRT complexes. The ESCRT-II complex may also play a role in transcription regulation, possibly via its interaction with ELL. Binds phosphoinosides such as PtdIns(3,4,5)P3.
  • Sequence similarities

    Belongs to the VPS36 family.
    Contains 1 GLUE C-terminal domain.
    Contains 1 GLUE N-terminal domain.
  • Domain

    The GLUE domain (GRAM-like ubiquitin-binding in EAP45) mediates binding to ubiquitin and phosphoinosides.
  • Cellular localization

    Cytoplasm. Endosome. Late endosome. Membrane. Nucleus. Colocalizes with ubiquitinated proteins on late endosomes. Recruited to the endosome membrane to participate in vesicle formation.
  • Information by UniProt

Images

  • ab162398 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162398 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162398.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up