Recombinant Human VPS37A protein (ab165405)

Overview

  • Product name
    Recombinant Human VPS37A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDV EYRLPFTINNLTININILLPPQFPQEKPVISVYPPIRHHLMDKQGVYVTS PLVNNFTMHSDLGKIIQSLLDEFWKNPPVLAPTSTAFPYLYSNPSGMSPY ASQGFPFLPPYPPQEANRSITSLSVADTVSSSTTSHTTAKPAAPSFGVLS NLPLPIPTVDASIPTSQNGFGYKMPDVPDAFPELSELSVSQLTDMNEQEE VLLEQFLTLPQLKQIITDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDK YELLTQMKSTFEKKMQRQHELSEICSASALQARLKVAAHEAEEESDNIAE DFLEGKMEIDDFLSSFMEKRTICHCRRAKEEKLQQAIAMHSQFHAPL
    • Amino acids
      1 to 397
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165405 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2210018P21Rik
    • 4930592A21Rik
    • AW261445
    • D8Ertd531e
    • ESCRT I complex subunit VPS37A
    • FLJ32642
    • FLJ42616
    • HCRP1
    • hepatocellular carcinoma related protein 1
    • hVps37A
    • MGC116266
    • polyglutamine binding protein 2
    • PQBP2
    • vacuolar protein sorting 37A
    • Vacuolar protein sorting associated protein 37A
    see all
  • Relevance
    VPS37A, vacuolar protein sorting 37A, is a component of the ESCRT-I complex, a regulator of vesicular trafficking process. It is required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies and may be involved in cell growth and differentiation.
  • Cellular localization
    Late endosome membrane; Peripheral membrane protein. Nucleus.

Images

  • ab165405 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165405 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165405.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up