Overview

  • Product name
    Recombinant Human VPS39 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MHDAFEPVPILEKLPLQIDCLAAWEEWLLVGTKQGHLLLYRIRKDVGCNR FEVTLEKSNKNFSKKIQQIHVVSQFKILVSLLENNIYVHDLLTFQQITTV SKAKGASLFTCDLQHTETGEEVLRMCVAVKKKLQLYFWKDREFHELQGDF SVPDVPKSMAWCENSICVGFKRDYYLIRVDGKGSIKELFPTGKQLEPLVA PLADGKVAVGQDDLTVVLNEEGICTQKCALNWTDIPVAMEHQPPYIIAVL PRYVEIRTFEPRLLVQSIELQRPRFITSGGSNIIYVASNHFVWRLIPVPM ATQIQQLLQDKQFELALQLAEMKDDSDSEKQQQIHHIKNLYAFNLFCQKR FDESMQVFAKLGTDPTHVMGLYPDLLPTDYRKQLQYPNPLPVLSGAELEK AHLALIDYLTQKRSQLVKKLNDSDHQSSTSPLMEGTPTIKSKKKLLQIID TTLLKCYLHTNVALVAPLLRLENNHCHIEESEHVLKKAHKYSELIILYEK KGLHEKALQVLVDQSKKANSPLKGHERTVQYLQHLGTENLHLIFSYSVWV LRDFPEDGLKIFTEDLPEVESLPRDRVLGFLIENFKGLAIPYLEHIIHVW EETGSRFHNCLIQLYCEKVQGLMKEYLLSFPAGKTPVPAGEEEGELGEYR QKLLMFLEISSYYDPGRLICDFPFDGLLEERALLLGRMGKHEQALFIYVH ILKDTRMAEEYCHKHYDRNKDGNKDVYLSLLRMYLSPPSIHCLGPIKLEL LEPKANLQAALQVLELHHSKLDTTKALNLLPANTQINDIRIFLEKVLEEN AQKKRFNQVLKNLLHAEFLRVQEERILHQQVKCIITEEKVCMVCKKKIGN SAFARYPNGVVVHYFCSKEVNPADT
    • Amino acids
      1 to 875
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161608 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A230065P22Rik
    • AW743070
    • FLJ21681
    • FLJ46546
    • hVam6p
    • KIAA0770
    • RP23-348L16.12
    • TLP
    • TRAP1 like protein
    • Vacuolar protein sorting 39
    • Vacuolar protein sorting 39 homolog
    • VAM6
    • Vam6/Vps39 like
    • Vam6/Vps39 like protein
    • Vam6/Vps39-like protein
    • VPS 39
    • Vps39
    • VPS39_HUMAN
    see all
  • Function
    May play a role in clustering and fusion of late endosomes and lysosomes.
  • Tissue specificity
    Ubiquitous. Highly expressed in heart, skeletal muscle, kidney, pancreas, brain, placenta and lung.
  • Sequence similarities
    Belongs to the VAM6/VPS39 family.
    Contains 1 CNH domain.
  • Cellular localization
    Cytoplasm. Lysosome membrane. Late endosome membrane.
  • Information by UniProt

Images

  • ab161608 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161608 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161608.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up