Overview

  • Product name

    Recombinant Human VPS41 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAEAVEQETGSLEESTDESEEEESEEEPKLKYERLSNGVTEILQKDAASC MTVHDKFLALGTHYGKVYLLDVQGNITQKFDVSPVKINQISLDESGEHMG VCSEDGKVQVFGLYSGEEFHETFDCPIKIIAVHPHFVRSSCKQFVTGGKK LLLFERSWMNRWKSAVLHEGEGNIRSVKWRGHLIAWANNMGVKIFDIISK QRITNVPRDDISLRPDMYPCSLCWKDNVTLIIGWGTSVKVCSVKERHASE MRDLPSRYVEIVSQFETEFYISGLAPLCDQLVVLSYVKEISEKTEREYCA RPRLDIIQPLSETCEEISSDALTVRGFQENECRDYHLEYSEGESLFYIVS PRDVVVAKERDQDDHIDWLLEKKKYEEALMAAEISQKNIKRHKILDIGLA YINHLVERGDYDIAARKCQKILGKNAALWEYEVYKFKEIGQLKAISPYLP RGDPVLKPLIYEMILHEFLESDYEGFATLIREWPGDLYNNSVIVQAVRDH LKKDSQNKTLLKTLAELYTYDKNYGNALEIYLTLRHKDVFQLIHKHNLFS SIKDKIVLLMDFDSEKAVDMLLDNEDKISIKKVVEELEDRPELQHVYLHK LFKRDHHKGQRYHEKQISLYAEYDRPNLLPFLRDSTHCPLEKALEICQQR NFVEETVYLLSRMGNSRSALKMIMEELHDVDKAIEFAKEQDDGELWEDLI LYSIDKPPFITGLLNNIGTHVDPILLIHRIKEGMEIPNLRDSLVKILQDY NLQILLREGCKKILVADSLSLLKKMHRTQMKGVLVDEENICESCLSPILP SDAAKPFSVVVFHCRHMFHKECLPMPSMNSAAQFCNICSAKNRGPGSAIL EMKK
    • Molecular weight

      125 kDa including tags
    • Amino acids

      1 to 854

Specifications

Our Abpromise guarantee covers the use of ab132476 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HVPS41
    • hVps41p
    • HVSP41
    • S53
    • Vacuolar assembly protein 41
    • Vacuolar protein sorting 41 (yeast homolog)
    • Vacuolar protein sorting 41 (yeast)
    • Vacuolar protein sorting 41 homolog (S. cerevisiae)
    • Vacuolar protein sorting associated protein 41 homolog
    • vacuolar protein sorting-associated protein 41 homolog
    • VPS 41
    see all
  • Relevance

    VPS41 is required for vacuolar assembly and vacuolar traffic. Vesicle mediated protein sorting plays an important role in segregation of intracellular molecules into distinct organelles. Genetic studies in yeast have identified more than 40 vacuolar protein sorting (VPS) genes involved in vesicle transport to vacuoles. VSP41 is the human ortholog of yeast Vps41 protein which is also conserved in Drosophila, tomato, and Arabidopsis. Expression studies in yeast and human indicate that this protein may be involved in the formation and fusion of transport vesicles from the Golgi. Several transcript variants encoding different isoforms have been described for this gene, however, the full-length nature of not all is known.
  • Cellular localization

    Cytoplasmic face of coated pits and vesicles.

Images

  • 12.5% SDS-PAGE analysis of ab132476 stained with Coomassie Blue

References

ab132476 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132476.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up